Property Summary

NCBI Gene PubMed Count 21
PubMed Score 48.80
PubTator Score 38.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.200 2.7e-03
Astrocytoma, Pilocytic 1.200 4.8e-05
Chronic Lymphocytic Leukemia -1.069 1.1e-02
dermatomyositis 1.100 7.8e-04
gastric carcinoma 1.600 1.5e-02
head and neck cancer and chronic obstruc... 1.100 7.3e-04
interstitial cystitis 1.500 2.4e-03
lung adenocarcinoma -1.298 2.0e-03
lung cancer -2.500 1.2e-05
lung carcinoma -1.300 2.9e-17
mucosa-associated lymphoid tissue lympho... 1.027 4.5e-02
non primary Sjogren syndrome sicca -1.300 2.1e-02
non-small cell lung cancer -1.266 7.9e-09
ovarian cancer -2.400 1.2e-08
tuberculosis 1.600 4.1e-07
ulcerative colitis 2.100 4.7e-05

Gene RIF (17)

AA Sequence

MTSEITYAEVRFKNEFKSSGINTASSAASKERTAPHKSNTGFPKLLCASLLIFFLLLAISFFIAFVIFFQ      1 - 70
KYSQLLEKKTTKELVHTTLECVKKNMPVEETAWSCCPKNWKSFSSNCYFISTESASWQDSEKDCARMEAH     71 - 140
LLVINTQEEQDFIFQNLQEESAYFVGLSDPEGQRHWQWVDQTPYNESSTFWHPREPSDPNERCVVLNFRK    141 - 210
SPKRWGWNDVNCLGPQRSVCEMMKIHL                                               211 - 237
//

Text Mined References (22)

PMID Year Title