Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.37
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.100 4.7e-03
posterior fossa group A ependymoma -2.200 4.4e-19
glioblastoma -2.000 2.2e-07
oligodendroglioma -1.100 9.6e-19
sonic hedgehog group medulloblastoma -1.800 4.6e-08
atypical teratoid / rhabdoid tumor -1.700 5.0e-06
medulloblastoma, large-cell -2.000 3.1e-07
primitive neuroectodermal tumor -1.400 2.5e-03
adult high grade glioma -2.300 9.3e-08
pilocytic astrocytoma -2.100 2.4e-11
psoriasis 1.500 3.8e-17

AA Sequence

MEPAREPPSRARPPPPLAARPAPAPAAPRPRSPAEAEARGPEGLLRRSGSGYEGSTSWKAALEDTTTRLL      1 - 70
LGAIAVLLFAILVVMSILASKGCIKCEAPCPEDWLLYGRKCYFFSEEPRDWNTGRQYCHTHEAVLAVIQS     71 - 140
QKELEFMFKFTRREPWIGLRRVGDEFHWVNGDPFDPDTFTIAGPGECVFVEPTRLVSTECLMTRPWVCSK    141 - 210
MAYT                                                                      211 - 214
//

Text Mined References (3)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
11181995 2001 The sequence of the human genome.