Property Summary

NCBI Gene PubMed Count 47
PubMed Score 60.06
PubTator Score 39.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 3.2e-04
ovarian cancer 8491 2.2e-03

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.500 3.2e-04
ovarian cancer 1.600 2.2e-03

Gene RIF (23)

PMID Text
26561856 Data show that claudin-6 (CLDN6) R209Q and occludin (OCLN) P24A mutations do not affect HCV pseudoparticles (HCVpp) entry.
26191261 The expression of ASK1 is correlated with the level of claudin-6 in cervical carcinoma cells and tissues.
24710653 High levels of CLDN6 are associated with non-small-cell lung cancer.
23919729 The expression of claudin-6 was down regulated in gastric cancer tissue.
23864633 Although claudin-6 and claudin-9 can serve as entry factors in cell lines, hepatitis C virus infection into human hepatocytes is not dependent on claudin-6 and claudin-9.
23778593 This work provides a proof of concept for the use of Claudin-6 to eliminate residual undifferentiated human pluripotent stem cells from culture.
23775920 Only some hepatitis C virus strains efficiently use CLDN6 for infection.
22925655 ASK1 signal may play a positive role in the inhibitory effect of claudin-6 in breast cancer.
22455563 Our results show that claudin-6 protein is significantly down-regulated in breast invasive ductal carcinomas
21989342 CLDN6 is not a specific biomarker for atypical teratoid rhabdoid tumors as it is expressed in a variety of other pediatric CNS and soft tissue tumors.
20874001 Increased expression of claudin-6, claudin-7, or claudin-9 is sufficient to enhance tumorigenic properties of a gastric adenocarcinoma cell line.
20388399 17beta-E2 might regulate the expression of claudin-6 and inhibit the proliferation and migration of MCF-7 cells.
20367941 The up-regulation of claudin-6 expression in MCF-7 breast cancer cells suppresses their malignant phenotypes with a correlation with the restoration of tight junction integrity.
20215972 claudin-6, downregulates the malignant phenotype of breast carcinoma.
20118769 Claudin 6 was not found in epithelioid glioblastomas or rhabdoid glioblastomas.
19960275 Claudins 6, 7, and 9 expressions are closely related to gastric carcinogenesis
19773279 Observational study of gene-disease association. (HuGE Navigator)
19288010 Methylation of CLDN6, FBN2, RBP1, RBP4, TFPI2, and TMEFF2 in esophageal squamous cell carcinoma.
19220299 CLDN6 may be a useful positive marker to help further identify atypical teratoid/rhabdoid tumors for diagnostic and treatment purposes
18976975 Knockdown of claudin 6 (CLDN6) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18234789 claudin-6 and claudin-9 expressed in CD81+ cells also enable the entry of HCV pseudoparticles derived from six of the major genotypes.
17804490 CLDN6 and CLDN9, but not CLDN1, are expressed in peripheral blood mononuclear cells, an additional site of HCV replication.
12736707 CLDN6, clustered with CLDN9 at human chromosome 16p13.3, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

AA Sequence

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSL      1 - 70
LALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTA     71 - 140
HAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRG    141 - 210
PSEYPTKNYV                                                                211 - 220
//

Text Mined References (49)

PMID Year Title
26561856 2015 Claudin-6 and Occludin Natural Variants Found in a Patient Highly Exposed but Not Infected with Hepatitis C Virus (HCV) Do Not Confer HCV Resistance In Vitro.
26191261 2015 Expression of apoptosis signal-regulating kinase 1 is associated with tight junction protein claudin-6 in cervical carcinoma.
24710653 2014 Aberrantly activated claudin 6 and 18.2 as potential therapy targets in non-small-cell lung cancer.
23919729 2013 The distinct expression patterns of claudin-2, -6, and -11 between human gastric neoplasms and adjacent non-neoplastic tissues.
23864633 2013 Functional analysis of claudin-6 and claudin-9 as entry factors for hepatitis C virus infection of human hepatocytes by using monoclonal antibodies.
23778593 2013 Immunologic and chemical targeting of the tight-junction protein Claudin-6 eliminates tumorigenic human pluripotent stem cells.
23775920 2014 Isolate-dependent use of claudins for cell entry by hepatitis C virus.
22925655 2012 Apoptosis signal-regulating kinase 1 is associated with the effect of claudin-6 in breast cancer.
22455563 2012 The expression patterns and correlations of claudin-6, methy-CpG binding protein 2, DNA methyltransferase 1, histone deacetylase 1, acetyl-histone H3 and acetyl-histone H4 and their clinicopathological significance in breast invasive ductal carcinomas.
21989342 2012 Claudin-6 is a nonspecific marker for malignant rhabdoid and other pediatric tumors.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20874001 2011 Claudin-6, 7, or 9 overexpression in the human gastric adenocarcinoma cell line AGS increases its invasiveness, migration, and proliferation rate.
20388399 2010 [Effects of 17?-estradiol on proliferation and migration of MCF-7 cell by regulating expression of claudin-6].
20367941 2010 [Effects of stable up-regulation of tight junction protein claudin-6 upon biological phenotypes of breast cancer cell MCF-7].
20215972 2010 Tight junction protein, claudin-6, downregulates the malignant phenotype of breast carcinoma.
20118769 2010 Epithelioid versus rhabdoid glioblastomas are distinguished by monosomy 22 and immunohistochemical expression of INI-1 but not claudin 6.
19960275 2010 Distribution and expression pattern of claudins 6, 7, and 9 in diffuse- and intestinal-type gastric adenocarcinomas.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19706201 2009 The claudins.
19288010 2009 Methylation of CLDN6, FBN2, RBP1, RBP4, TFPI2, and TMEFF2 in esophageal squamous cell carcinoma.
19220299 2010 Claudin 6 is a positive marker for atypical teratoid/rhabdoid tumors.
18234789 2008 The tight junction proteins claudin-1, -6, and -9 are entry cofactors for hepatitis C virus.
18036336 2008 Structure and function of claudins.
17804490 2007 Claudin-6 and claudin-9 function as additional coreceptors for hepatitis C virus.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15541721 2005 Activation of p21CIP1/WAF1 gene expression and inhibition of cell proliferation by overexpression of hepatocyte nuclear factor-4alpha.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454572 2004 Disruption of the cingulin gene does not prevent tight junction formation but alters gene expression.
15366020 2004 Expression patterns of claudin family of tight junction membrane proteins in developing mouse submandibular gland.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12896909 2003 Identification of genes preferentially expressed in mammary epithelial cells of Copenhagen rat using subtractive hybridization and microarrays.
12749857 2003 Hepatocyte nuclear factor (HNF)-4alpha triggers formation of functional tight junctions and establishment of polarized epithelial morphology in F9 embryonal carcinoma cells.
12736707 2003 CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475568 2003 Tight junction proteins.
12231346 2002 Claudin-based barrier in simple and stratified cellular sheets.
12110008 2002 The renal segmental distribution of claudins changes with development.
12060405 2002 Molecular architecture of tight junctions of periderm differs from that of the maculae occludentes of epidermis.
11923212 2002 Permeability barrier dysfunction in transgenic mice overexpressing claudin 6.
11912246 2002 Differential expression patterns of claudins, tight junction membrane proteins, in mouse nephron segments.
11668606 2001 Claudin-6: a novel tight junction molecule is developmentally regulated in mouse embryonic epithelium.
11283726 2001 Multifunctional strands in tight junctions.
11247307 2001 The roles of claudin superfamily proteins in paracellular transport.
10690502 2000 Tight junctions of the blood-brain barrier.
10601346 1999 Direct binding of three tight junction-associated MAGUKs, ZO-1, ZO-2, and ZO-3, with the COOH termini of claudins.
10508865 1999 Endothelial claudin: claudin-5/TMVCF constitutes tight junction strands in endothelial cells.
9892664 1999 Claudin multigene family encoding four-transmembrane domain protein components of tight junction strands.