Property Summary

NCBI Gene PubMed Count 85
PubMed Score 313.33
PubTator Score 181.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
medulloblastoma, large-cell -1.500 4.4e-05
non-small cell lung cancer -2.203 9.2e-23
intraductal papillary-mucinous adenoma (... -1.500 6.3e-06
intraductal papillary-mucinous carcinoma... -1.400 1.9e-04
intraductal papillary-mucinous neoplasm ... -1.700 1.9e-04
breast carcinoma -2.700 9.0e-06
fibroadenoma -2.100 5.4e-03
interstitial cystitis 1.200 1.6e-03
lung adenocarcinoma -4.000 1.7e-29
psoriasis -1.400 2.6e-08
non-inflammatory breast cancer -2.200 3.6e-03
ductal carcinoma in situ -2.100 1.8e-05
invasive ductal carcinoma -2.600 4.2e-05
dermatomyositis 1.400 1.9e-03

Synonym

Accession O00501 B3KS11 Q53XW2 Q8WUW3
Symbols AWAL
BEC1
TMVCF
CPETRL1

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (73)

PMID Text
27010153 The levels of ESM1, CLDN5, IL-1beta, IL-6, and TNF-alpha were significantly higher in the migraine attack group than in the control group
26654362 analysis of the membrane driven cis interactions of claudin-5 proteins in the formation of the blood brain barrier tight junctions
26464708 the expression of claudin-5 and claudin-9 was down-regulated while the expression of claudin-8 was up-regulated in cervical carcinoma tissues compared with adjacent non-neoplastic tissues.
26409663 Plasma CLDN5 levels decreased in patients with stable asthma compared with those in control subjects, suggesting that asthma therapy can decrease plasma CLDN5 levels
25973092 the relationship between vWF and claudin-5, which are indicators of endothelial cell dysfunction and tight junction activity, may be a predictor of disease activity in rheumatoid arthritis.
25667483 An association between strong claudin-5 expression and higher serum levels of TATI (p=0.04) and CA125 (p=0.008) were found
25452107 miR-18a and RUNX1 could reversely regulate the permeability of blood-tumor barrier as well as the expressions and distributions of ZO-1, occludin and claudin-5.
25440958 These data support that loss of claudin-5 in cardiomyocytes and endothelial cells is prevalent in human heart failure
25345514 The findings suggest that down regulated CLDN1 and CLDN5 genes have potential relevance in relation to the progression of glioblastoma multiforme.
25342221 Data show that C-terminal domain of Clostridium perfringens enterotoxin (cCPE)-binding to claudin 1 and claudin 5 is prevented by two residues in extracellular loop 2 of Cld1 (Asn(150) and Thr(153)) and Cld5 (Asp(149) and Thr(151)).
25323998 Claudin-5 overexpression promoted the interactions of claudin-1 and claudin-2 and enhanced the barrier function of retinal cells.
24840331 The exposure to HIV-1 or HIV-1 gp120 results in a significant downregulation of tight junction proteins ZO-1, Occludin, Claudin-1, Claudin-2, Claudin-3, Claudin-4, and Claudin-5 in human retinal pigment epithelial cells
24815833 The present study demonstrates that high expression of claudins 1, 4, 5 and down-regulation of claudin-7 are positive prognostic markers and are associated with good outcome and increased survival rates.
24519061 loss of claudin 5 expression in the tumour vasculature points to a leaky vessel type
24478310 folding and assembly of CLDN3 and CLDN5 into the tight junction are controlled by non-conserved residues in the transmembrane 3 and extracellular loop 2 segments
24318462 luciferase assays and chromatin immunoprecipitation assays showed that KLF4 up-regulated the promoter activities and interacted with "CACCC" DNA sequence presented in the promoters of ZO-1, occludin, and claudin-5.
24028293 silencing of claudin-5 did significantly attenuate simvastatin-mediated endothelial cell barrier protection in response to thrombin
23554480 The exposure to HIV-1 or HIV-1 gp120 results in a significant downregulation of tight junction proteins ZO-1, Occludin, Claudin-1, Claudin-2, Claudin-3, Claudin-4, and Claudin-5 in human retinal pigment epithelial cells
23505411 Matrix metalloproteinase-9 leads to claudin-5 degradation via the NF-kappaB pathway in BALB/c mice with eosinophilic meningoencephalitis caused by Angiostrongylus cantonensis.
23474739 VE-cadherin and claudin-5 were studied in nasal polyp microvessels.
23465821 Chorionic gonadotropin induces VEGFA-dependent downregulation of claudin 5, which increases the endothelial permeability in the coculture system.
23288152 Claudin-5 expression and junctional organization controls intercellular barriers of human dermal microvascular but not human umbilical vein endothelial cells.
23115643 Over-expression of claudin-5 was sufficient to prevent replication-deficient virus-induced permeability
23000880 Letter: confirm the endothelial cell origin of cutaneous angiosarcoma and demonstrate that both endoglin and claudin-5 show promise as markers for cutaneous angiosarcoma.
22700861 CLDN5 gene DNA meyhylation suggesting the pathogenesis of idiopathic pulmonary fibrosis.
22591361 The exposure to HIV-1 or HIV-1 gp120 results in a significant downregulation of tight junction proteins ZO-1, Occludin, Claudin-1, Claudin-2, Claudin-3, Claudin-4, and Claudin-5 in human retinal pigment epithelial cells
22559840 Study portrays a role for Claudin-5 in cell motility involving the N-WASP signalling cascade indicating a possible role for Claudin-5 in the metastasis of human breast cancer.
22448134 The exposure to HIV-1 or HIV-1 gp120 results in a significant downregulation of tight junction proteins ZO-1, Occludin, Claudin-1, Claudin-2, Claudin-3, Claudin-4, and Claudin-5 in human retinal pigment epithelial cells
22389112 study demonstrated that claudin 5 is a protein with a short half-life that can undergo polyubiquitinationmainly on lysine 199, which apparently leads to its subsequent degradation
22333621 Galphai2 as a novel claudin-5 partner required for TJ integrity in brain endothelial cells.
22235125 ERG plays a pivotal role in regulating endothelial cell barrier function and that this effect is mediated in part through its regulation of CLDN5 gene expression.
22038628 this study portrays a new and interesting role for Claudin-5 in cell motility involving the N-WASP and ROCK signalling cascade
22002662 GDNF increased the expression of claudin-5 and the transendothelial electrical resistance (TEER) of BMECs and PnMECs, whereas BDNF did not have this effect
21959309 Claudin-5 is a promising new marker for angiosarcomas and hemangioendotheliomas.
21857898 Data suggest that the degradation of tight junction proteins ZO-1, claudin-5 and occludin by MMP-2 and -9 secreted by leukemic cells constitutes an important mechanism in the BBB breakdown which contributes to the invasion of leukemic cells to the CNS.
21772312 Interendothelial claudin-5 expression depends on cerebral endothelial cell-matrix adhesion by beta(1)-integrins.
21717370 The exposure to HIV-1 or HIV-1 gp120 results in a significant downregulation of tight junction proteins ZO-1, Occludin, Claudin-1, Claudin-2, Claudin-3, Claudin-4, and Claudin-5 in human retinal pigment epithelial cells
21641584 The exposure to HIV-1 or HIV-1 gp120 results in a significant downregulation of tight junction proteins ZO-1, Occludin, Claudin-1, Claudin-2, Claudin-3, Claudin-4, and Claudin-5 in human retinal pigment epithelial cells
21168935 tyrosine phosphorylation of claudin-5 is involved in the increased paracellular permeability of central nervous system-derived vascular endothelium induced by TGF-beta1.
20525806 This study sought to determine the cell signaling mechanism controlling endothelial CLDN5 expression during acute lung injury.
20478039 Claudin-1, -3, -4, -5, and -7 are expressed in developing human lung from week 12 to week 40 with distinct locations and in divergent quantities.
20452046 The results of this study showed weak association of the CLDN5 locus with schizophrenia in Chinese.
20452046 Observational study of gene-disease association. (HuGE Navigator)
20044634 Increased claudin-5 expression is associated with aggressive behavior in serous ovarian adenocarcinoma.
19538285 Structure and function of extracellular claudin domains
19231096 claudin-4, in addition to 1 and 5, might be a useful differential diagnostic marker of lung cancer in Korean people.
19194274 Expression pattern of claudins 5 and 7 distinguishes solid-pseudopapillary from pancreatoblastoma, acinar cell and endocrine tumors of the pancreas.
19168871 Endothelial claudin 5 expression levels is associated with increased permeability.
18941231 The exposure to HIV-1 or HIV-1 gp120 results in a significant downregulation of tight junction proteins ZO-1, Occludin, Claudin-1, Claudin-2, Claudin-3, Claudin-4, and Claudin-5 in human retinal pigment epithelial cells
18817843 For the first time this study proves the presence of Claudin-1, Claudin-3 and Claudin-5 in ECV304 (obtained from ECACC) cell layers and the inducibility of their expression by glioma-conditioned media.
18797402 Observational study of gene-disease association. (HuGE Navigator)
18604199 endothelial VE-cadherin at AJs upregulates the gene encoding the TJ adhesive protein claudin-5
18513742 claudin-5 may participate in novel mechanisms in the pathway to end-stage heart failure.
18329007 The exposure to HIV-1 or HIV-1 gp120 results in a significant downregulation of tight junction proteins ZO-1, Occludin, Claudin-1, Claudin-2, Claudin-3, Claudin-4, and Claudin-5 in human retinal pigment epithelial cells
18065521 an obligatory role for SOX-18 in the regulation of claudin-5 gene expression in an endothelial-specific and cell density-dependent manner is established
18003888 The exposure to HIV-1 or HIV-1 gp120 results in a significant downregulation of tight junction proteins ZO-1, Occludin, Claudin-1, Claudin-2, Claudin-3, Claudin-4, and Claudin-5 in human retinal pigment epithelial cells
17765294 Data show that claudin-5 was only detected in human umbilical vein endothelial cells derived from healthy newborns with a strong family history of myocardial infarction.
17761522 data for the first time explain how two claudins hold onto each other and constrict the paracellular space. The intermolecular interface includes aromatic (F147, Y148, Y158) and hydrophilic (Q156, E159) residues
17585317 Squamous cell carcinomas were positive for CLDN-1 and negative for CLDN-5, whereas adenocarcinomas were positive for CLDN-5 and negative for CLDN-1.
17103306 Claudin tight junction proteins in endoscopy biopsy samples showed Barrett's metaplasia contains more claudin-2 and claudin-3 than found in normal esophageal mucosa, but markedly lower claudins 1 and 5, indicating very different tight junction barriers.
16959372 overexpression of claudin-5 leads to formation of elaborate networks of junction strands, which are absent in untransduced endothelial cells
16697675 The exposure to HIV-1 or HIV-1 gp120 results in a significant downregulation of tight junction proteins ZO-1, Occludin, Claudin-1, Claudin-2, Claudin-3, Claudin-4, and Claudin-5 in human retinal pigment epithelial cells
16514648 gamma linolenic acid, iodine, and selenium alone, or in combination are able to strengthen the function of tight junctions in human endothelial cells, by way of regulating the distribution of Claudin-5, Occludin, and ZO-1
16181776 Observational study of gene-disease association. (HuGE Navigator)
16158492 CLDN5 may be classified as a tight junction protein capable of "sealing" a tight junction.
15820333 CLDN5 may be associated with schizophrenia in Chinese of Han descent
15617864 CLDN5 may be involved in forming a permeability barrier in the gut and, together with DQB, confer a susceptibility to schizophrenia.
15363474 CLDN5 protein may predispose to schizophrenia
15260435 Showed that residues located C-terminal to the last transmembrane domain of claudin 5 are required for the proper targeting to apical TJ.s.
14515355 The exposure to HIV-1 or HIV-1 gp120 results in a significant downregulation of tight junction proteins ZO-1, Occludin, Claudin-1, Claudin-2, Claudin-3, Claudin-4, and Claudin-5 in human retinal pigment epithelial cells
12909588 Airway tight junctions are regulated by claudin interactions that confer the selectivity of the junction.
12743111 The Blood-Brain Barrier against small molecules (<800 D), but not larger molecules, was selectively affected in Claudin-5 deficient mice.
11944085 Claudin 5 is transiently expressed during the development of the retinal pigment epithelium.

AA Sequence

MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSV      1 - 70
LALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFA     71 - 140
NIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATG    141 - 210
DYDKKNYV                                                                  211 - 218
//

Text Mined References (86)

PMID Year Title
27010153 2016 Serum levels of endocan, claudin-5 and cytokines in migraine.
26654362 2016 Molecular Architecture of the Blood Brain Barrier Tight Junction Proteins--A Synergistic Computational and In Vitro Approach.
26464708 2015 Expression of claudin-5, -7, -8 and -9 in cervical carcinoma tissues and adjacent non-neoplastic tissues.
26409663 2015 Claudin 5 in a murine model of allergic asthma: Its implication and response to steroid treatment.
25973092 2015 Roles of claudin-5 and von Willebrand factor in patients with rheumatoid arthritis.
25816133 2015 Tumor necrosis factor disrupts claudin-5 endothelial tight junction barriers in two distinct NF-?B-dependent phases.
25667483 2015 Claudin-5 is associated with elevated TATI and CA125 levels in mucinous ovarian borderline tumors.
25452107 2015 MiR-18a increased the permeability of BTB via RUNX1 mediated down-regulation of ZO-1, occludin and claudin-5.
25440958 Claudin-5 levels are reduced from multiple cell types in human failing hearts and are associated with mislocalization of ephrin-B1.
25345514 2014 Down regulated expression of Claudin-1 and Claudin-5 and up regulation of ?-catenin: association with human glioma progression.
25342221 2015 Directed structural modification of Clostridium perfringens enterotoxin to enhance binding to claudin-5.
25323998 2014 The effect of claudin-5 overexpression on the interactions of claudin-1 and -2 and barrier function in retinal cells.
24815833 Expression of claudins-1, -4, -5, -7 and occludin in hepatocellular carcinoma and their relation with classic clinicopathological features and patients' survival.
24519061 2014 Strong claudin 5 expression is a poor prognostic sign in pancreatic adenocarcinoma.
24478310 2014 Claudin-3 and claudin-5 protein folding and assembly into the tight junction are controlled by non-conserved residues in the transmembrane 3 (TM3) and extracellular loop 2 (ECL2) segments.
24318462 2014 Krüppel-like factor 4 regulates blood-tumor barrier permeability via ZO-1, occludin and claudin-5.
24028293 2014 Role of claudin-5 in the attenuation of murine acute lung injury by simvastatin.
23626836 2013 Anthrax lethal toxin downregulates claudin-5 expression in human endothelial tight junctions.
23505411 2013 Matrix metalloproteinase-9 leads to claudin-5 degradation via the NF-?B pathway in BALB/c mice with eosinophilic meningoencephalitis caused by Angiostrongylus cantonensis.
23474739 2013 Decreased expression of VE-cadherin and claudin-5 and increased phosphorylation of VE-cadherin in vascular endothelium in nasal polyps.
23465821 2013 Human chorionic gonadotropin controls luteal vascular permeability via vascular endothelial growth factor by down-regulation of a cascade of adhesion proteins.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23288152 2013 Claudin-5 controls intercellular barriers of human dermal microvascular but not human umbilical vein endothelial cells.
23115643 2012 Influenza infects lung microvascular endothelium leading to microvascular leak: role of apoptosis and claudin-5.
23000880 2012 Endoglin (CD105) and claudin-5 expression in cutaneous angiosarcoma.
22700861 2012 Altered DNA methylation profile in idiopathic pulmonary fibrosis.
22559840 2012 Claudin-5 is involved in breast cancer cell motility through the N-WASP and ROCK signalling pathways.
22389112 2012 The ubiquitin-proteasome pathway regulates claudin 5 degradation.
22333621 2012 Guanine nucleotide-binding protein G?i2: a new partner of claudin-5 that regulates tight junction integrity in human brain endothelial cells.
22235125 2012 ETS-related gene (ERG) controls endothelial cell permeability via transcriptional regulation of the claudin 5 (CLDN5) gene.
22038628 2012 Claudin-5 participates in the regulation of endothelial cell motility.
22002662 2012 Pericyte-derived glial cell line-derived neurotrophic factor increase the expression of claudin-5 in the blood-brain barrier and the blood-nerve barrier.
21959309 2011 Claudin-5 as an immunohistochemical marker for angiosarcoma and hemangioendotheliomas.
21857898 2011 Matrix metalloproteinase-2 and -9 secreted by leukemic cells increase the permeability of blood-brain barrier by disrupting tight junction proteins.
21772312 2011 Interendothelial claudin-5 expression depends on cerebral endothelial cell-matrix adhesion by ?(1)-integrins.
21168935 2011 Tyrosine phosphorylation of VE-cadherin and claudin-5 is associated with TGF-?1-induced permeability of centrally derived vascular endothelium.
20525806 2011 Endothelial dysfunction and claudin 5 regulation during acrolein-induced lung injury.
20478039 2010 Divergent expression of claudin -1, -3, -4, -5 and -7 in developing human lung.
20452046 2010 A weak association of the CLDN5 locus with schizophrenia in Chinese case-control samples.
20044634 2009 Claudin-5 overexpression correlates with aggressive behavior in serous ovarian adenocarcinoma.
19924644 2010 Claudins in human cancer: a review.
19706201 2009 The claudins.
19538285 2009 Structure and function of extracellular claudin domains.
19231096 2009 Diagnostic utility of expression of claudins in non-small cell lung cancer: different expression profiles in squamous cell carcinomas and adenocarcinomas.
19194274 2009 Expression pattern of claudins 5 and 7 distinguishes solid-pseudopapillary from pancreatoblastoma, acinar cell and endocrine tumors of the pancreas.
19168871 2009 Molecular mechanisms of ovarian hyperstimulation syndrome: paracrine reduction of endothelial claudin 5 by hCG in vitro is associated with increased endothelial permeability.
18817843 2008 Expression of Claudin-1, Claudin-3 and Claudin-5 in human blood-brain barrier mimicking cell line ECV304 is inducible by glioma-conditioned media.
18797402 2008 Replication study for associations between polymorphisms in the CLDN5 and DGCR2 genes in the 22q11 deletion syndrome region and schizophrenia.
18604199 2008 Endothelial adherens junctions control tight junctions by VE-cadherin-mediated upregulation of claudin-5.
18513742 2008 Claudin-5 levels are reduced in human end-stage cardiomyopathy.
18065521 2008 SOX-18 controls endothelial-specific claudin-5 gene expression and barrier function.
18036336 2008 Structure and function of claudins.
17765294 2008 Altered detection of molecules associated with leukocyte traffic in HUVECs derived from newborns with a strong family history of myocardial infarction.
17761522 2008 Formation of tight junction: determinants of homophilic interaction between classic claudins.
17585317 2007 Claudin-1 and claudin-5 expression patterns differentiate lung squamous cell carcinomas from adenocarcinomas.
17103306 2006 Transepithelial leak in Barrett's esophagus.
16959372 2006 Limited contribution of claudin-5-dependent tight junction strands to endothelial barrier function.
16514648 2006 Synergistic regulation of endothelial tight junctions by antioxidant (Se) and polyunsaturated lipid (GLA) via Claudin-5 modulation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16181776 2005 A study of the combined effect of the CLDN5 locus and the genes for the phospholipid metabolism pathway in schizophrenia.
16158492 2005 Contribution of claudin-5 to barrier properties in tight junctions of epithelial cells.
15820333 2005 Further study of a genetic association between the CLDN5 locus and schizophrenia.
15617864 2005 Gene, gut and schizophrenia: the meeting point for the gene-environment interaction in developing schizophrenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15363474 2004 The CLDN5 locus may be involved in the vulnerability to schizophrenia.
15260435 2004 The C-terminal cytoplasmic tail of claudins 1 and 5 but not its PDZ-binding motif is required for apical localization at epithelial and endothelial tight junctions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14515355 2003 HIV-1 Tat protein alters tight junction protein expression and distribution in cultured brain endothelial cells.
12909588 2003 Role of claudin interactions in airway tight junctional permeability.
12743111 2003 Size-selective loosening of the blood-brain barrier in claudin-5-deficient mice.
12734665 2003 Localization of claudin-3 in tight junctions of the blood-brain barrier is selectively lost during experimental autoimmune encephalomyelitis and human glioblastoma multiforme.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475568 2003 Tight junction proteins.
12403818 2002 Distinct claudins and associated PDZ proteins form different autotypic tight junctions in myelinating Schwann cells.
12231346 2002 Claudin-based barrier in simple and stratified cellular sheets.
11283726 2001 Multifunctional strands in tight junctions.
11247307 2001 The roles of claudin superfamily proteins in paracellular transport.
10690502 2000 Tight junctions of the blood-brain barrier.
10601346 1999 Direct binding of three tight junction-associated MAGUKs, ZO-1, ZO-2, and ZO-3, with the COOH termini of claudins.
10591208 1999 The DNA sequence of human chromosome 22.
9892664 1999 Claudin multigene family encoding four-transmembrane domain protein components of tight junction strands.
9441748 1997 Analysis of a human gene homologous to rat ventral prostate.1 protein.
9192844 1997 Identification, characterization, and precise mapping of a human gene encoding a novel membrane-spanning protein from the 22q11 region deleted in velo-cardio-facial syndrome.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.