Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 2.1e-19

AA Sequence

MVWFCNSADCQFSVFALTTIGWILSSTSTGLVEWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTK      1 - 70
FCYRYSYQDTFLPFEISMAQRFLLTASIFGFFGRAFNMFALRNMSMRMFEEDTYNSFVVSGILNIAAGVF     71 - 140
NLIAVLQNYDAVINSQGITFLPSLQMPFKPDVQEVGTAIQVAGIGVLPMLLTGMFSLFYKCPPYGQVHPG    141 - 210
ISEM                                                                      211 - 214
//

Text Mined References (2)

PMID Year Title
23726886 2013 Phylogenetic revision of the claudin gene family.
15772651 2005 The DNA sequence of the human X chromosome.