Property Summary

NCBI Gene PubMed Count 33
PubMed Score 38.74
PubTator Score 39.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Protein-protein Interaction (2)

Gene RIF (22)

PMID Text
26919807 Data suggest that claudin-18 suppresses the abnormal proliferation and motility of lung epithelial cells mediated by inhibition of phosphorylation of pyruvate dehydrogenase kinase isoform 1 (PDK1) and proto-oncogene protein c-akt (Akt).
24787463 Human fetal lungs at 23-24 weeks gestational age, the highest-risk period for developing bronchopulmonary dysplasia, a disease of impaired alveolarization, had significantly lower CLDN18 expression relative to postnatal lungs.
24710653 High levels of CLDN18 are associated with non-small-cell lung cancer.
24647998 Downregulation of miR-1303 can inhibit proliferation, migration and invasion of gastric cancer cells by targeting CLDN18.
24333468 Evaluated expression of claudins in gastric cancer and determined their significance for patient outcome. Claudin-3 and claudin-7 were expressed in 25.4% and 29.9% of gastric cancer tissues; 51.5% of gastric cancer tissues had reduced claudin-18.
24073219 Down-regulation of claudin-18 is associated with the proliferative and invasive potential of gastric cancer.
23905715 Claudin-18 positivity is a specific phenotype that is characteristic of intestinal-type Mucinous borderline tumours of the ovary
23900716 rate of CLDN18.2 positivity is high in pancreatic neoplasms whereby the expression is not limited to the primaries but is also maintained upon metastasis
23570326 Reduced expression of olfactomedin 4 and ectopic expression of claudin-18 might be useful markers in the differential diagnosis of serrated polyps.
22076167 Claudin 10/18 are most commonly expressed in lung adenocarcinomas. Female patients and non-smokers express these claudins more commonly suggesting that they may play a part in the carcinogenesis of tobacco unrelated carcinoma.
21832145 Claudin 18 (a marker for early carcinogenesis) is commonly expressed in precursor lesions of pancreatic ductal adenocarcinomas. Activation of the protein kinase C pathway might be involved in claudin 18 expression associated with carcinogenesis.
21607649 These results suggest that CLDN18 may play an important role in biliary carcinogenesis.
21381080 Cldn18 is primarily regulated at the transcriptional level via specific protein kinase C signaling pathways and modified by DNA methylation
21206985 High claudin 18 is associated with intraductal papillary mucinous neoplasms of the pancreas.
20846265 We revealed that claudin-18 expression correlates with poor survival in patients with colorectal cancer and is associated with the gastric phenotype.
19047087 CLDN18.2 as a novel, highly attractive pan-cancer target for the antibody therapy of epithelial tumors.
18831034 Increased expression of claudin-18 is associated with colitis.
18580680 Claudin 18 staining can aid in diagnosis of gastrointestinal signet ring cell carcinoma.
18223320 Claudin 18 and annexin A8 are frequently highly overexpressed in infiltrating ductal adenocarcinomas.
18032479 Indicate that the PKC/MAPK/AP-1 dependent pathway regulates claudin-18a2 expression in gastric cells.
17932229 We conclude that Cldn-18 is the dominant claudin in the TJ of SCE and propose that the change from a Cldn-18-deficient TJ in SqE to a Cldn-18-rich TJ in SCE contributes to the greater acid resistance of BE.
17459057 Loss of claudin expression may enhance the grade of malignancy of gastric cancer in vivo.

AA Sequence

MSTTTCQVVAFLLSILGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVRQSSGFTECRPYFTIL      1 - 70
GLPAMLQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLTSGIMFIVSGLCAIAGVSVFA     71 - 140
NMLVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLAPEETNYKAVS    141 - 210
YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV                       211 - 261
//

Text Mined References (34)

PMID Year Title
26919807 2016 Claudin-18 inhibits cell proliferation and motility mediated by inhibition of phosphorylation of PDK1 and Akt in human lung adenocarcinoma A549 cells.
24787463 2014 Claudin-18 deficiency results in alveolar barrier dysfunction and impaired alveologenesis in mice.
24710653 2014 Aberrantly activated claudin 6 and 18.2 as potential therapy targets in non-small-cell lung cancer.
24647998 2014 miR-1303 targets claudin-18 gene to modulate proliferation and invasion of gastric cancer cells.
24333468 2014 Expression of claudin-7 and loss of claudin-18 correlate with poor prognosis in gastric cancer.
24073219 2013 Down-regulation of claudin-18 is associated with the proliferative and invasive potential of gastric cancer at the invasive front.
23905715 2013 Claudin-18 overexpression in intestinal-type mucinous borderline tumour of the ovary.
23900716 2014 Claudin 18.2 is a target for IMAB362 antibody in pancreatic neoplasms.
23570326 2013 Expression of olfactomedin 4 and claudin-18 in serrated neoplasia of the colorectum: a characteristic pattern is associated with sessile serrated lesion.
22076167 2011 Claudins 10 and 18 are predominantly expressed in lung adenocarcinomas and in tumors of nonsmokers.
21832145 2011 Claudin-18 is an early-stage marker of pancreatic carcinogenesis.
21607649 2011 Claudin-18 in biliary neoplasms. Its significance in the classification of intrahepatic cholangiocarcinoma.
21381080 2011 Transcriptional regulation of claudin-18 via specific protein kinase C signaling pathways and modification of DNA methylation in human pancreatic cancer cells.
21206985 2011 Immunohistochemical analysis of claudin expression in pancreatic cystic tumors.
20846265 2010 Immunohistochemical analysis of colorectal cancer with gastric phenotype: claudin-18 is associated with poor prognosis.
19706201 2009 The claudins.
19047087 2008 Claudin-18 splice variant 2 is a pan-cancer target suitable for therapeutic antibody development.
18831034 2008 Increased expression of the tight junction molecule claudin-18 A1 in both experimental colitis and ulcerative colitis.
18580680 2008 Immunohistochemical staining of Reg IV and claudin-18 is useful in the diagnosis of gastrointestinal signet ring cell carcinoma.
18223320 2008 New markers of pancreatic cancer identified through differential gene expression analyses: claudin 18 and annexin A8.
18036336 2008 Structure and function of claudins.
18032479 2008 Transcriptional activation of the human claudin-18 gene promoter through two AP-1 motifs in PMA-stimulated MKN45 gastric cancer cells.
17932229 2007 Claudin-18: a dominant tight junction protein in Barrett's esophagus and likely contributor to its acid resistance.
17459057 2007 Gastric and intestinal claudin expression at the invasive front of gastric carcinoma.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475568 2003 Tight junction proteins.
12231346 2002 Claudin-based barrier in simple and stratified cellular sheets.
11585919 2001 claudin-18, a novel downstream target gene for the T/EBP/NKX2.1 homeodomain transcription factor, encodes lung- and stomach-specific isoforms through alternative splicing.
11283726 2001 Multifunctional strands in tight junctions.
11247307 2001 The roles of claudin superfamily proteins in paracellular transport.
10690502 2000 Tight junctions of the blood-brain barrier.