Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.21
PubTator Score 2.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Down syndrome 548
Muscle Weakness 92
Disease Target Count P-value
psoriasis 6685 1.3e-126
osteosarcoma 7933 6.6e-07

Gene RIF (3)

PMID Text
26194246 The structural features of Cldn17 contributing to anion channel formation are presented in this work.
24325792 Claudin 17 expression was down-regulated in gastric cancer.
12736707 CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

AA Sequence

MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARVRLQCKFYSSL      1 - 70
LALPPALETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWT     71 - 140
ANIIIRDFYNPAIHIGQKRELGAALFLGWASAAVLFIGGGLLCGFCCCNRKKQGYRYPVPGYRVPHTDKR    141 - 210
RNTTMLSKTSTSYV                                                            211 - 224
//

Text Mined References (18)

PMID Year Title
26194246 2016 Molecular basis of claudin-17 anion selectivity.
24325792 2013 The distinct expression patterns of claudin-10, -14, -17 and E-cadherin between adjacent non-neoplastic tissues and gastric cancer tissues.
22402829 2012 Claudin-17 forms tight junction channels with distinct anion selectivity.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
19706201 2009 The claudins.
18036336 2008 Structure and function of claudins.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12736707 2003 CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475568 2003 Tight junction proteins.
12231346 2002 Claudin-based barrier in simple and stratified cellular sheets.
12067061 2002 Organization and formation of the tight junction system in human epidermis and cultured keratinocytes.
11283726 2001 Multifunctional strands in tight junctions.
11247307 2001 The roles of claudin superfamily proteins in paracellular transport.
10830953 2000 The DNA sequence of human chromosome 21.
10690502 2000 Tight junctions of the blood-brain barrier.