Property Summary

Ligand Count 2
NCBI Gene PubMed Count 21
PubMed Score 32.76
PubTator Score 29.97

Knowledge Summary

Patent (19,634)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
MENTAL RETARDATION, X-LINKED 49 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 1.1

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.776 2.5e-03
active ulcerative colitis 1.238 8.1e-03
adrenocortical carcinoma 1.467 1.0e-03
adult high grade glioma -1.500 6.0e-06
astrocytic glioma -1.200 8.2e-03
Astrocytoma, Pilocytic -1.200 1.9e-08
atypical teratoid / rhabdoid tumor -1.800 8.2e-08
cystic fibrosis -1.700 1.1e-04
ependymoma -1.600 4.0e-03
glioblastoma -1.200 6.2e-07
group 4 medulloblastoma 1.600 3.5e-03
intraductal papillary-mucinous neoplasm ... 2.100 1.8e-02
malignant mesothelioma -1.100 1.5e-04
medulloblastoma, large-cell -2.700 5.7e-04
mucosa-associated lymphoid tissue lympho... 1.021 7.6e-03
oligodendroglioma -1.700 3.8e-02
osteosarcoma -2.431 4.9e-03
Pick disease -1.200 3.8e-03
primitive neuroectodermal tumor -1.200 2.0e-03
subependymal giant cell astrocytoma -1.865 3.3e-02

Gene RIF (10)

AA Sequence

MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFHTIDWLREKSRDTDRHRKITSKSKESIWEFIKSLLDAWSG      1 - 70
WVVMLLIGLLAGTLAGVIDLAVDWMTDLKEGVCLSAFWYSHEQCCWTSNETTFEDRDKCPLWQKWSELLV     71 - 140
NQSEGASAYILNYLMYILWALLFAFLAVSLVRVFAPYACGSGIPEIKTILSGFIIRGYLGKWTLLIKTVT    141 - 210
LVLVVSSGLSLGKEGPLVHVACCCGNFFSSLFSKYSKNEGKRREVLSAAAAAGVSVAFGAPIGGVLFSLE    211 - 280
EVSYYFPLKTLWRSFFAALVAAFTLRSINPFGNSRLVLFYVEYHTPWYMAELFPFILLGVFGGLWGTLFI    281 - 350
RCNIAWCRRRKTTRLGKYPVLEVIVVTAITAIIAYPNPYTRQSTSELISELFNDCGALESSQLCDYINDP    351 - 420
NMTRPVDDIPDRPAGVGVYTAMWQLALALIFKIVVTIFTFGMKIPSGLFIPSMAVGAIAGRMVGIGVEQL    421 - 490
AYHHHDWIIFRNWCRPGADCVTPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMAAAVTSK    491 - 560
WVADAFGKEGIYEAHIHLNGYPFLDVKDEFTHRTLATDVMRPRRGEPPLSVLTQDSMTVEDVETLIKETD    561 - 630
YNGFPVVVSRDSERLIGFAQRRELILAIKNARQRQEGIVSNSIMYFTEEPPELPANSPHPLKLRRILNLS    631 - 700
PFTVTDHTPMETVVDIFRKLGLRQCLVTRSGRLLGIITKKDVLRHMAQMANQDPESIMFN              701 - 760
//

Text Mined References (25)

PMID Year Title