Property Summary

NCBI Gene PubMed Count 10
PubMed Score 71.74
PubTator Score 9.94

Knowledge Summary

Patent (12,925)

Expression

  Differential Expression (14)

Disease log2 FC p
cystic fibrosis 2.700 1.2e-03
ependymoma -2.400 4.5e-02
esophageal adenocarcinoma -4.100 2.3e-02
glioblastoma multiforme -1.100 2.4e-08
oligodendroglioma -1.100 1.3e-06
non-small cell lung cancer 1.318 1.4e-04
colon cancer -4.700 1.4e-03
interstitial cystitis -4.100 8.7e-03
nasopharyngeal carcinoma -2.900 2.7e-04
spina bifida -1.391 4.3e-02
progressive supranuclear palsy -1.800 1.2e-02
Breast cancer -2.700 8.5e-70
Down syndrome 1.100 3.3e-03
chronic rhinosinusitis 1.869 1.2e-02

Gene RIF (5)

PMID Text
24386311 CLCA4 and CLCA2 play complementary but distinct roles in epithelial differentiation
23073314 CLCA4 modulates the capability to express residual chloride secretion in colonic tissue.
19460752 Knockdown of chloride channel accessory 4 (CLCA4) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
15490240 CLCA1 and CLCA4 may have roles as modulators of the gastrointestinal basic defect in cystic fibrosis
10758170 HIV-1 gp120 from both CCR5- and CXCR4-tropic HIV-1 strains opens calcium-activated potassium (K(Ca)), chloride, and calcium-permeant nonselective cation channels in macrophages; these signals are mediated by CCR5 and CXCR4

AA Sequence

MGLFRGFVFLLVLCLLHQSNTSFIKLNNNGFEDIVIVIDPSVPEDEKIIEQIEDMVTTASTYLFEATEKR      1 - 70
FFFKNVSILIPENWKENPQYKRPKHENHKHADVIVAPPTLPGRDEPYTKQFTECGEKGEYIHFTPDLLLG     71 - 140
KKQNEYGPPGKLFVHEWAHLRWGVFDEYNEDQPFYRAKSKKIEATRCSAGISGRNRVYKCQGGSCLSRAC    141 - 210
RIDSTTKLYGKDCQFFPDKVQTEKASIMFMQSIDSVVEFCNEKTHNQEAPSLQNIKCNFRSTWEVISNSE    211 - 280
DFKNTIPMVTPPPPPVFSLLKISQRIVCLVLDKSGSMGGKDRLNRMNQAAKHFLLQTVENGSWVGMVHFD    281 - 350
STATIVNKLIQIKSSDERNTLMAGLPTYPLGGTSICSGIKYAFQVIGELHSQLDGSEVLLLTDGEDNTAS    351 - 420
SCIDEVKQSGAIVHFIALGRAADEAVIEMSKITGGSHFYVSDEAQNNGLIDAFGALTSGNTDLSQKSLQL    421 - 490
ESKGLTLNSNAWMNDTVIIDSTVGKDTFFLITWNSLPPSISLWDPSGTIMENFTVDATSKMAYLSIPGTA    491 - 560
KVGTWAYNLQAKANPETLTITVTSRAANSSVPPITVNAKMNKDVNSFPSPMIVYAEILQGYVPVLGANVT    561 - 630
AFIESQNGHTEVLELLDNGAGADSFKNDGVYSRYFTAYTENGRYSLKVRAHGGANTARLKLRPPLNRAAY    631 - 700
IPGWVVNGEIEANPPRPEIDEDTQTTLEDFSRTASGGAFVVSQVPSLPLPDQYPPSQITDLDATVHEDKI    701 - 770
ILTWTAPGDNFDVGKVQRYIIRISASILDLRDSFDDALQVNTTDLSPKEANSKESFAFKPENISEENATH    771 - 840
IFIAIKSIDKSNLTSKVSNIAQVTLFIPQANPDDIDPTPTPTPTPTPDKSHNSGVNISTLVLSVIGSVVI    841 - 910
VNFILSTTI                                                                 911 - 919
//

Text Mined References (16)

PMID Year Title
24386311 2013 Loss of CLCA4 promotes epithelial-to-mesenchymal transition in breast cancer cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23073314 2013 CLCA4 variants determine the manifestation of the cystic fibrosis basic defect in the intestine.
18254958 2008 Transcriptomic dissection of tongue squamous cell carcinoma.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16012037 2005 Expression and distribution of ion transport mRNAs in human nasal mucosa and nasal polyps.
15490240 2004 The CLCA gene locus as a modulator of the gastrointestinal basic defect in cystic fibrosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11071307 2000 Molecular characteristics and functional diversity of CLCA family members.
10437792 1999 Identification of three novel members of the calcium-dependent chloride channel (CaCC) family predominantly expressed in the digestive tract and trachea.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.