Property Summary

NCBI Gene PubMed Count 84
PubMed Score 276.33
PubTator Score 295.83

Knowledge Summary

Patent (18,981)

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.500 5.3e-03
lung adenocarcinoma 1.200 2.5e-03
gastric carcinoma -4.000 6.5e-03
psoriasis -2.500 4.8e-47

Protein-protein Interaction (3)

Gene RIF (63)

PMID Text
26738403 Data show that a low serum creatine kinase activity is more common in female than male, and is associated with older age.
26118042 The serum expression levels of myocardial creatine kinase and of galectin-3 reflect the physiopathology state of children with congenital heart defects after surgical correction.
26027379 Based on the obtained results, it may be speculated that the CKM A/G polymorphism is not an important determinant of endurance performance level in Polish and Russian rowers.
25802449 CK-MB mass is more significant criteria of myocardial injury.
25214527 The variant rs11559024 in the CKM gene (Glu83Gly) was significantly associated with CK levels of statin users.
25141318 CK-MB levels were higher after ERCP in non-ischemic patients compared with a myocardial ischemia group. Creatine phosphokinase levels did not differ significantly between groups.
24846126 serum CK-MB elevated in underweight hemodialysis patients
24673369 Asymptomatic hyper-CKemia is an uncommon association with hyponatremia of various etiologies.
24625749 troponin T and creatinine kinase isoenzyme (CK-MB) have roles in combined renal and myocardial injuries in asphyxiated infants
24602118 Substantive creatine phosphokinase increases and rhabdomyolysis with statin use were particularly seen in patients starting treatment, those on large daily doses or interacting drugs or with larger numbers of concomitant drugs
24189370 elderly women classified as high response experienced greater serum response to eccentric resistance exercise
23993326 Cardiac enzyme elevations post-cardiac bypass or post-percutaneous coronary intervention are associated with an adverse long-term mortality; the causes of which are multifactorial.
23876027 Estimation of CK and its CK isoenzyme fractions can aid in quick and accurate diagnosis of tubal ectopic pregnancy.
23436474 3D mapping of the CK reaction rates and metabolic fluxes can be achieved in the skeletal muscle in vivo at relatively high spatial resolution and with acquisition times well tolerated by patients.
23274523 The crystal structure of CK indicates that the E79 and K138 interaction plays key roles in sustaining the recognition between N-terminal and C-terminal domains of muscle creatine kinase.
23122801 The current enzymatic definition of procedural myocardial infarct (MI) (CK-myocardial band more than 3 times the upper limit of normal) used in clinical trials is less strongly associated with death than that of spontaneous MI.
22592287 High levels of blood creatine-kinase MB are associated with embolism source during acute phase of ischemic stroke.
21931810 The results suggested that the intra- and inter-subunit domain interactions modified the behavior of kinetic refolding.
21873942 This study explored the relationship of cardiac function examined by echocardiography and serum creatine kinase (CK) and CK-MB levels with myocardial ischemia-reperfusion injury in a cohort of Chinese acute myocardial infarction patients.
21768101 strong down-regulation of MCK activity contributes to F-actin instability and induces post-translational modification of alphaB-crystallin and desmin
21706313 Creatine kinase MM TaqI and methylenetetrahydrofolate reductase C677T and A1298C gene polymorphisms influence exercise-induced C-reactive protein levels.
21516340 Results indicate that these polymorphisms can indirectly influence performance, contribute to higher susceptibility to exercise-induced inflammation or protection against it, and perhaps affect future risks of CVD in athletes.
21456469 The overall efficacy of IMA [ischemia modified albumin]in differentiating AMI[Acute Myocardial Infarction] from Non-AMI cases appears to be comparable to that of CK-MB and cTnI
21448949 Cardiac troponin T and creatine kinase have roles in infarct size and left ventricular function after acute myocardial infarction
21426302 Muscle-type creatine kinase physically interacts with the slow skeletal muscle-type MyBPC1 (myosin-binding protein C1).
20952631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20669347 percutaneous coronary intervention induces temporal changes of P-selectin, Mg, and CK-MB, which may be involved in restenosis and ischemia-reperfusion injury, but not PAI-1
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20591515 Elevated creatine kinase-MB is associated with elevated white blood cell count and atherosclerotic plaque in patients with elective stent implantation.
20588308 Observational study of gene-disease association. (HuGE Navigator)
20588136 A single troponin I value at 3 days from symptom onset is a better predictor of infarct size compared to peak values and CK-MB.
20558199 two residues close to the dimer interface of MMCK were crucial for species-specific thermal stability
20536908 Common variants of MSTN and CKM genes don't play a role in attaining high level endurance performance in Caucasians.
20536908 Observational study of gene-disease association. (HuGE Navigator)
20157874 The researchers found no association between the CK response after exercise and the presence of the CK-MM NcoI polymorphism.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19670037 Elevated CK-MB values after elective angioplasty predicts reduced long-term event-free survival.
19523464 The Dimension Vista cTnI, CK-MB, MYO, NTproBNP, and hsCRP methods demonstrate acceptable performance characteristics for use as an aid in the diagnosis and risk assessment of patients presenting with suspected acute coronary syndromes.
19422651 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19337554 Report the effects of prior calcium channel blocker therapy on creatine kinase-MB (myocardial form) levels after percutaneous coronary interventions.
19125286 Plasma CPK was increased at 10 km of the marathon race and up to threefold at the end of the race. This was further increased on day 1, only returning to pre-race level on day 6. Plasma CPK was increased 35-fold at the end of the 200-km race
19039220 CK-MB values > or =5 times the reference after elective cardiac surgery are associated with reduced long-term event-free survival
18833644 We suggest that the occurrence of familial hyperCKemia may have triggered the early onset of symptoms in our patient.
18810980 Cardiac involvement of major thalassemia and evaluation of total serum CK-mB isoenzyme in these patients is reported.
18801770 Observational study of gene-disease association. (HuGE Navigator)
18055044 Muscle type CK elevation in hypertrabeculation/noncompaction suggests neuromuscular disorder and prompts neurological investigations.
17885020 Indicate a positive association of the ACE ID genotype with creatine kinase response to strenuous exercise. Genotype may determine risk for developing muscle damage.
17478608 CK-MM AA genotype and percent body fat may be part of the constellation of mechanisms that explain susceptibility to exertional rhabdomyolysis.
17303563 generation of O-CK is a negative regulation of R-CK and O-CK might play essential roles in the molecular turnover of MM-CK
17000714 Observational study of gene-disease association. (HuGE Navigator)
16981706 The results show conclusively that, Cys283 is not responsible for the pKa of 5.4 observed in the WT V/K(creatine) pH profile.
16810680 CK-MM autoantibodies can modulate the rate of CK clearance from the circulation in myositis
16373479 first monomeric intermediate captured during refolding of muscle-type creatine kinase; authors propose that aggregation is caused by interaction between such monomeric intermediates.
16120572 Observational study of genotype prevalence. (HuGE Navigator)
16092153 Elevated levels of creatinine kinase-MB after percutaneous coronary intervention are not a predictor of adverse outcomes
16087811 Creatinine kinase-MB levels are elevated after adverse outcomes following percutaneous coronary interventions
16079652 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16037885 Observational study of gene-disease association. (HuGE Navigator)
16037885 In top-level professional cyclists capable of completing a classic 3-wk tour race, the frequency distribution of the D allele and the DD genotype seems to be higher than in other endurance athletes such as elite runners.
15504039 The roles of Ile-69 and Val-325 are discussed in the delivery of both substrate specificity and catalysis of human muscle creatine kinase isozyme.
12972258 Results identify muscle-type creatine kinase as a binding partner of a central portion of myomesin and the closely related M-protein.
11922612 A short version of the muscle creatine kinase promoter(MCK1350) allows for sustained dystrophin expression in skeletal muscle of newborn mdx mice.

AA Sequence

MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIM      1 - 70
TVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGY     71 - 140
TLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARD    141 - 210
WPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYV    211 - 280
LTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQV    281 - 350
QLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK                                           351 - 381
//

Text Mined References (84)

PMID Year Title
26738403 2015 Low serum creatine kinase activity in hospital patients.
26118042 [BIOCHEMICAL MARKERS OF MYOCARDIAL DAMAGE IN CHILDREN AFTER SURGICAL CORRECTION OF CONGENITAL HEART DISEASE].
26027379 2015 CKM gene polymorphism in Russian and Polish rowers.
25802449 2015 Study of CK-MB activity in patients with acute myocardial infarction after percutaneous coronary intervention.
25416956 2014 A proteome-scale map of the human interactome network.
25214527 2014 CKM and LILRB5 are associated with serum levels of creatine kinase.
25141318 2014 Role of serum myeloperoxidase, CPK, CK-MB, and cTnI tests in early diagnosis of myocardial ischemia during ERCP.
24846126 2014 A comparison of markers of myocardial injury and their relation to nutritional parameters in hemodialysis patients.
24673369 2014 Asymptomatic elevation of creatine kinase in patients with hyponatremia.
24625749 2014 The diagnostic value of both troponin T and creatinine kinase isoenzyme (CK-MB) in detecting combined renal and myocardial injuries in asphyxiated infants.
24602118 2014 Predictors and outcomes of increases in creatine phosphokinase concentrations or rhabdomyolysis risk during statin treatment.
24189370 2014 Identification of high responders for interleukin-6 and creatine kinase following acute eccentric resistance exercise in elderly obese women.
23993326 2013 Incidence, correlates, and significance of abnormal cardiac enzyme rises in patients treated with surgical or percutaneous based revascularisation: a substudy from the Synergy between Percutaneous Coronary Interventions with Taxus and Cardiac Surgery (SYNTAX) Trial.
23876027 2013 Diagnostic significance of total creatine kinase and its isoform in tubal ectopic pregnancy.
23436474 2013 Three-dimensional mapping of the creatine kinase enzyme reaction rate in muscles of the lower leg.
23274523 2013 Disrupting of E79 and K138 interaction is responsible for human muscle creatine kinase deficiency diseases.
23122801 2012 Comparison of the prognosis of spontaneous and percutaneous coronary intervention-related myocardial infarction.
22592287 2012 Biomarker level improves the diagnosis of embolic source in ischemic stroke of unknown origin.
21931810 2011 Dissimilarity in the folding of human cytosolic creatine kinase isoenzymes.
21873942 2011 Altered serum creatine kinase level and cardiac function in ischemia-reperfusion injury during percutaneous coronary intervention.
21768101 2011 Muscle creatine kinase deficiency triggers both actin depolymerization and desmin disorganization by advanced glycation end products in dilated cardiomyopathy.
21706313 2012 Creatine kinase MM TaqI and methylenetetrahydrofolate reductase C677T and A1298C gene polymorphisms influence exercise-induced C-reactive protein levels.
21516340 2012 Creatine kinase MM TaqI and methylenetetrahydrofolate reductase C677T and A1298C gene polymorphisms influence exercise-induced C-reactive protein levels.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21456469 2011 Diagnosis of ischemic heart disease using CK-MB, troponin-I and ischemia modified albumin.
21448949 2011 Cardiac troponin T and creatine kinase predict mid-term infarct size and left ventricular function after acute myocardial infarction: a cardiac MR study.
21426302 2011 Slow skeletal muscle myosin-binding protein-C (MyBPC1) mediates recruitment of muscle-type creatine kinase (CK) to myosin.
20952631 2010 Association of single-nucleotide polymorphisms from 17 candidate genes with baseline symptom-limited exercise test duration and decrease in duration over 20 years: the Coronary Artery Risk Development in Young Adults (CARDIA) fitness study.
20669347 2010 Temporal changes in circulating P-selectin, plasminogen activator inhibitor-1, magnesium, and creatine kinase after percutaneous coronary intervention.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20591515 2011 Impact of plaque morphology on creatine kinase-MB elevation in patients with elective stent implantation.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20588136 2010 Predictive value of cardiac troponin-I compared to creatine kinase-myocardial band for the assessment of infarct size as measured by cardiac magnetic resonance.
20558199 2010 Dissecting the key residues crucial for the species-specific thermostability of muscle-type creatine kinase.
20536908 2011 Single nucleotide polymorphisms in the myostatin (MSTN) and muscle creatine kinase (CKM) genes are not associated with elite endurance performance.
20157874 2010 CK-MM gene polymorphism does not influence the blood CK activity levels after exhaustive eccentric exercise.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19670037 2010 Elevated CK-MB values after routine angioplasty predicts worse long-term prognosis in low-risk patients.
19523464 2009 Cardiovascular disease testing on the Dimension Vista system: biomarkers of acute coronary syndromes.
19422651 2010 Does the polygenic profile determine the potential for becoming a world-class athlete? Insights from the sport of rowing.
19337554 2008 The effects of prior calcium channel blocker therapy on creatine kinase-MB levels after percutaneous coronary interventions.
19125286 2009 Changes in serum cartilage oligomeric matrix protein (COMP), plasma CPK and plasma hs-CRP in relation to running distance in a marathon (42.195 km) and an ultra-marathon (200 km) race.
19039220 2009 Long-term prognostic value of creatine kinase-myocardial band mass after cardiac surgery in low-risk patients with stable angina.
18833644 2008 Duchenne muscular dystrophy and idiopathic hyperCKemia in the same family.
18810980 2008 Cardiac involvement of major thalassemia and evaluation of total serum creatine kinase and creatine kinase-mB isoenzyme and cardiac troponinI in these patients.
18801770 2010 World-class performance in lightweight rowing: is it genetically influenced? A comparison with cyclists, runners and non-athletes.
18055044 2008 Significance of CK-elevation in noncompaction with regard to cardiac and neuromuscular disease.
17885020 2007 ACE ID genotype affects blood creatine kinase response to eccentric exercise.
17478608 2007 CK-MM and ACE genotypes and physiological prediction of the creatine kinase response to exercise.
17303563 2007 The generation of the oxidized form of creatine kinase is a negative regulation on muscle creatine kinase.
17000714 2006 Muscle-specific creatine kinase gene polymorphism and running economy responses to an 18-week 5000-m training programme.
16981706 2006 Exploring the role of the active site cysteine in human muscle creatine kinase.
16810680 2006 CK-MM autoantibodies: prevalence, immune complexes, and effect on CK clearance.
16373479 2006 Capture of monomeric refolding intermediate of human muscle creatine kinase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16289162 2006 The identification of myocilin-associated proteins in the human trabecular meshwork.
16120572 2005 [An A/G polymorphism in muscle-specific creatine kinase gene in Han population in Northern China].
16092153 2005 Does creatinine kinase-MB elevation after percutaneous coronary intervention predict outcomes in 2005? Cardiac enzyme elevation after successful percutaneous coronary intervention is not an independent predictor of adverse outcomes.
16087811 2005 Does creatinine kinase-MB elevation after percutaneous coronary intervention predict outcomes in 2005? Periprocedural cardiac enzyme elevation predicts adverse outcomes.
16079652 2005 The caregene study: muscle-specific creatine kinase gene and aerobic power in coronary artery disease.
16037885 Is there an association between ACE and CKMM polymorphisms and cycling performance status during 3-week races?
15504039 2004 Isoleucine 69 and valine 325 form a specificity pocket in human muscle creatine kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12972258 2003 Muscle-type creatine kinase interacts with central domains of the M-band proteins myomesin and M-protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12432079 2002 Subcellular targeting of metabolic enzymes to titin in heart muscle may be mediated by DRAL/FHL-2.
12039490 2002 Myocardial creatine kinase expression after left ventricular assist device support.
11922612 2002 The short MCK1350 promoter/enhancer allows for sufficient dystrophin expression in skeletal muscles of mdx mice.
10893433 2000 Creatine and creatinine metabolism.
10089465 1999 Crystallization and preliminary X-ray analysis of human muscle creatine kinase.
9748661 1998 Subunit conformation and dynamics in a heterodimeric protein: studies of the hybrid isozyme of creatine kinase.
8524781 1995 Sequence verification of human creatine kinase (43 kDa) isozymes by high-resolution tandem mass spectrometry.
7808454 Creatine kinase in non-muscle tissues and cells.
7805577 1993 Functional aspects of creatine kinase in brain.
7057800 1982 Creatine kinase activity in normal and Duchenne muscular dystrophy fibroblasts.
3778496 1986 Isolation and sequence analysis of a full-length cDNA for human M creatine kinase.
3031982 1987 cDNA cloning and mapping of the human creatine kinase M gene to 19q13.
2914937 1989 Isolation and characterization of the gene and cDNA encoding human mitochondrial creatine kinase.
2903158 1988 Developmental regulation and tissue-specific expression of the human muscle creatine kinase gene.
2331374 1990 Spermatogenesis-related change in the synthesis of the creatine kinase B-type and M-type isoforms in human spermatozoa.
2309701 1990 A long-range restriction map of the human chromosome 19q13 region: close physical linkage between CKMM and the ERCC1 and ERCC2 genes.
1690725 1990 Muscle creatine kinase isoenzyme expression in adult human brain.