Property Summary

NCBI Gene PubMed Count 74
PubMed Score 117.78
PubTator Score 530.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma -1.200 2.6e-03
fibroadenoma -1.700 1.1e-02
lung adenocarcinoma -1.100 1.1e-03
lung carcinoma 1.500 2.2e-19

Protein-protein Interaction (2)

Gene RIF (33)

PMID Text
26460485 SRC, LYN and CKB expression or DNA methylation could be useful markers for predicting tumor progression.
25538032 CK-B catalytic activity also helps in the formation of protrusive ruffle structures which are actin-dependent and abundant on the surface of both unstimulated and LPS-activated macrophages.
25141318 CK-MB levels were higher after ERCP in non-ischemic patients compared with a myocardial ischemia group. Creatine phosphokinase levels did not differ significantly between groups.
24518563 increased serum Ckbb reflects failure of osteoclasts or suppression of osteoclasts in children with osteogenesis imperfecta during neridronate treatment
23882694 We found that most patients with macular telangiectasia-2 possess retinal autoantibodies, the most prevalent of which were directed against AGL, RBP3, and CK-B.
23876027 Estimation of CK and its CK isoenzyme fractions can aid in quick and accurate diagnosis of tubal ectopic pregnancy.
23049898 analysis of SNPs and their effect on creatine kinase structure and function
22885020 effects of osmolytes on human brain-type creatine kinase folding
22623148 study found promoter SNPs of CKB and TPI1 were weakly associated with schizophrenia;in addition, IFNG polymorphisms were associated with schizophrenia; results suggest that IFNG and proteins affected by IFNG may play a role in the pathogenesis of schizophrenia
22418839 His103 and Phe107 in hASB9-2 are essential for binding to CKB.
22088263 de-methylated CKB gene is inherited that leads to high CKB expression levels in myeloic precursor cells in the bone marrow
21980054 Cigarette smoke induced carbonylation and subsequent degradation of creatine kinase B are involved in the regulation of senescence in bronchial epithelial cells.
21931810 The results suggested that the intra- and inter-subunit domain interactions modified the behavior of kinetic refolding.
21308735 Data demonstrate that the downregulation of CKB may play an important role in colon cancer progression by promoting EMT.
20923681 These observations suggested that the ability to generate the oxidized form could protect BBCK against the intracellular oxidative stress.
20721618 CKB was up-regulated in women older than 38 years, and its expression in cumulus cells was associated with embryo quality
20588136 A single troponin I value at 3 days from symptom onset is a better predictor of infarct size compared to peak values and CK-MB.
20520825 Phosphocreatine metabolism in the normal appearing white matter in multiple sclerosis is impaired due to decreased CK-B levels.
20460152 The correlation of CK-BB as a disease biomarker in both CNS and peripheral tissues from Huntington's disease mice and patients may provide a powerful means to assess disease progression and prognosis.
19405953 This protein has been found differentially expressed in the Wernicke's Area from patients with schizophrenia.
19337554 Report the effects of prior calcium channel blocker therapy on creatine kinase-MB (myocardial form) levels after percutaneous coronary interventions.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18977227 Three structural aspects of human-brain-type-creatine-kinase were identified by X-ray crystallography: the ligand-free-form at 2.2A; the ADP-Mg2+, nitrate, and creatine complex (transition-state-analogue complex; TSAC); and the ADP-Mg2+-complex at 2.0A.
18793185 Data show that dose-response inactivation by 4HNE (4-hydroxynonenal) of hBAT (human bile acid CoA:amino acid N-acyltransferase) and CKBB (cytosolic brain isoform of creatine kinase) is associated with site-specific modifications.
18682038 The Tat-CK fusion protein markedly increased endogenous CK activity levels within PC12 cells.
18566107 Using a yeast 2-hybrid it was discovered that the C-terminal domain of KCC3, that is lost in most hereditary motor and sensory neuropathy with agenesis of the corpus callosum-causing mutations, directly interacts with brain-specific creatine kinase.
18552983 Autoantibodies to EsteD and BB-CK produced in experimental autoimmune uveoretinitis -induced mice were also detected in some endogenous uveitis patients, suggesting that these proteins might be autoantigens.
18309274 The asymmetric unit contained two molecules of CKB, giving a crystal volume per protein mass (Vm) of 1.80 A3 Da-1 and a solvent content of 31.6%.
17036164 GM130 and BB-CK co-localize specifically in a transient fashion during early prophase of mitosis, when GM130 plays an important role in Golgi fragmentation that starts also at early prophase.
16424007 CKB was expressed in 78% of colon tumors
16384981 Observational study of gene-disease association. (HuGE Navigator)
15996648 Expression of CKB mRNA and CK-B sometimes occurred in blastic transformation of the hematopoietic system
12160938 2D fingerprinting & mass spectrometry reveal specific targets of protein oxidation in Alzheimer's disease brain, including creatine kinase BB, suggesting involvement of oxidatively modified proteins in neurodegeneration.

AA Sequence

MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIM      1 - 70
TVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGF     71 - 140
CLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARD    141 - 210
WPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYI    211 - 280
LTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELV    281 - 350
QMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK                                           351 - 381
//

Text Mined References (81)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26460485 2015 Deregulated Expression of SRC, LYN and CKB Kinases by DNA Methylation and Its Potential Role in Gastric Cancer Invasiveness and Metastasis.
25810257 2015 Creatine kinase B is necessary to limit myoblast fusion during myogenesis.
25538032 2015 Submembranous recruitment of creatine kinase B supports formation of dynamic actin-based protrusions of macrophages and relies on its C-terminal flexible loop.
25416956 2014 A proteome-scale map of the human interactome network.
25141318 2014 Role of serum myeloperoxidase, CPK, CK-MB, and cTnI tests in early diagnosis of myocardial ischemia during ERCP.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24518563 2014 Serum brain-type creatine kinase increases in children with osteogenesis imperfecta during neridronate treatment.
23882694 2013 Anti-retinal antibodies in patients with macular telangiectasia type 2.
23876027 2013 Diagnostic significance of total creatine kinase and its isoform in tubal ectopic pregnancy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23049898 2012 Effect of SNPs on creatine kinase structure and function: identifying potential molecular mechanisms for possible creatine kinase deficiency diseases.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22885020 2012 Effects of osmolytes on human brain-type creatine kinase folding in dilute solutions and crowding systems.
22623148 2012 Roles of interferon-gamma and its target genes in schizophrenia: Proteomics-based reverse genetics from mouse to human.
22418839 2012 Crystal structure of Human ASB9-2 and substrate-recognition of CKB.
22088263 2012 High levels of brain-type creatine kinase activity in human platelets and leukocytes: a genetic anomaly with autosomal dominant inheritance.
21980054 2012 Involvement of creatine kinase B in cigarette smoke-induced bronchial epithelial cell senescence.
21931810 2011 Dissimilarity in the folding of human cytosolic creatine kinase isoenzymes.
21308735 2011 Creatine kinase brain overexpression protects colorectal cells from various metabolic and non-metabolic stresses.
21269460 2011 Initial characterization of the human central proteome.
20923681 2011 Generation of the oxidized form protects human brain type creatine kinase against cystine-induced inactivation.
20721618 2010 Association of creatin kinase B and peroxiredoxin 2 expression with age and embryo quality in cumulus cells.
20588136 2010 Predictive value of cardiac troponin-I compared to creatine kinase-myocardial band for the assessment of infarct size as measured by cardiac magnetic resonance.
20520825 2010 Reduced creatine kinase B activity in multiple sclerosis normal appearing white matter.
20460152 Reduced creatine kinase as a central and peripheral biomarker in Huntington's disease.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19725078 2009 Proteomic analysis of increased Parkin expression and its interactants provides evidence for a role in modulation of mitochondrial function.
19405953 2009 Proteome analysis of schizophrenia patients Wernicke's area reveals an energy metabolism dysregulation.
19337554 2008 The effects of prior calcium channel blocker therapy on creatine kinase-MB levels after percutaneous coronary interventions.
19264780 2009 Involvement of creatine kinase B in hepatitis C virus genome replication through interaction with the viral NS4A protein.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19060904 2009 An empirical framework for binary interactome mapping.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18977227 2008 Structural studies of human brain-type creatine kinase complexed with the ADP-Mg2+-NO3- -creatine transition-state analogue complex.
18793185 2008 High-resolution mass spectrometry analysis of protein oxidations and resultant loss of function.
18682038 2008 HIV-1 Tat-mediated protein transduction of human brain creatine kinase into PC12 cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18566107 2008 HMSN/ACC truncation mutations disrupt brain-type creatine kinase-dependant activation of K+/Cl- co-transporter 3.
18552983 2008 Proteomic surveillance of retinal autoantigens in endogenous uveitis: implication of esterase D and brain-type creatine kinase as novel autoantigens.
18309274 2008 Overexpression, purification, and preliminary X-ray crystallographic analysis of human brain-type creatine kinase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17036164 2007 Brain-type creatine kinase BB-CK interacts with the Golgi Matrix Protein GM130 in early prophase.
16981706 2006 Exploring the role of the active site cysteine in human muscle creatine kinase.
16424007 2006 Altered expression and localization of creatine kinase B, heterogeneous nuclear ribonucleoprotein F, and high mobility group box 1 protein in the nuclear matrix associated with colon cancer.
16384981 2006 Functional candidate genes in age-related macular degeneration: significant association with VEGF, VLDLR, and LRP6.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15996648 2005 Increased creatine kinase BB activity and CKB mRNA expression in patients with hematologic disorders: relation to methylation status of the CKB promoter.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12160938 2002 Proteomic identification of oxidatively modified proteins in Alzheimer's disease brain. Part I: creatine kinase BB, glutamine synthase, and ubiquitin carboxy-terminal hydrolase L-1.
12039490 2002 Myocardial creatine kinase expression after left ventricular assist device support.
11487543 2001 Intestinal epithelial cells secrete exosome-like vesicles.
10893433 2000 Creatine and creatinine metabolism.
9748661 1998 Subunit conformation and dynamics in a heterodimeric protein: studies of the hybrid isozyme of creatine kinase.
9365161 1997 Phosphoglycerate mutase, 2,3-bisphosphoglycerate phosphatase and creatine kinase activity and isoenzymes in human brain tumours.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8186255 1994 Determination of the catalytic site of creatine kinase by site-directed mutagenesis.
7808454 Creatine kinase in non-muscle tissues and cells.
7637327 1995 Protein analysis of human maculae in relation to age-related maculopathy.
7057800 1982 Creatine kinase activity in normal and Duchenne muscular dystrophy fibroblasts.
6998544 1980 Immunohistochemical localization of creatine kinase-BB isoenzyme to astrocytes in human brain.
6846432 1983 Creatine kinase activity in human endometrium: relative distribution in isolated glands and stroma.
3899413 1985 Highly sensitive enzyme immunoassay for human creatine kinase BB isozyme.
3692484 1987 Structure and expression of the human creatine kinase B gene.
3514665 1986 Creatine kinase isoenzymes in spermatozoa.
3034271 1987 Human creatine kinase: isolation and sequence analysis of cDNA clones for the B subunit, development of subunit specific probes and determination of gene copy number.
2914937 1989 Isolation and characterization of the gene and cDNA encoding human mitochondrial creatine kinase.
2883200 1987 Human creatine kinase-B complementary DNA. Nucleotide sequence, gene expression in lung cancer, and chromosomal assignment to two distinct loci.
2828370 1988 Isolation of a functional human gene for brain creatine kinase.
2792236 1989 Developmental expression of creatine kinase isozymes in mammalian lens.
2771648 1989 Complete nucleotide sequence of the human creatine kinase B gene.
1840537 1991 Expression of the gene encoding human brain creatine kinase depends on sequences immediately following the transcription start point.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.
1117316 1975 Changes in creatine kinase and its isoenzymes in human fetal muscle during development.
466791 1979 Bioluminescence assay of creatine kinase and its isoenzymes in serum and cerebrospinal fluid.