Property Summary

NCBI Gene PubMed Count 10
PubMed Score 106.47
PubTator Score 15.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.200 1.1e-04
atypical teratoid / rhabdoid tumor -1.700 1.0e-05
glioblastoma -1.500 2.1e-04
interstitial cystitis -1.100 2.1e-04
intraductal papillary-mucinous neoplasm ... 1.400 2.1e-02
medulloblastoma, large-cell -1.200 1.4e-03
nasopharyngeal carcinoma -1.100 9.9e-05
ulcerative colitis -2.100 1.7e-08

Gene RIF (1)

AA Sequence

MERKNPSRESPRRLSAKVGKGTEMKKVARQLGMAAAESDKDSGFSDGSSECLSSAEQMESEDMLSALGWS      1 - 70
REDRPRQNSKTAKNAFPTLSPMVVMKNVLVKQGSSSSQLQSWTVQPSFEVISAQPQLLFLHPPVPSPVSP     71 - 140
CHTGEKKSDSRNYLPILNSYTKIAPHPGKRGLSLGPEEKGTSGVQKKICTERLGPSLSSSEPTKAGAVPS    141 - 210
SPSTPAPPSAKLAEDSALQGVPSLVAGGSPQTLQPVSSSHVAKAPSLTFASPASPVCASDSTLHGLESNS    211 - 280
PLSPLSANYSSPLWAAEHLCRSPDIFSEQRQSKHRRFQNTLVVLHKSGLLEITLKTKELIRQNQATQVEL    281 - 350
DQLKEQTQLFIEATKSRAPQAWAKLQASLTPGSSNTGSDLEAFSDHPAI                         351 - 399
//

Text Mined References (13)

PMID Year Title