Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.29
PubTator Score 12.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma multiforme -1.400 2.8e-12
posterior fossa group B ependymoma -1.600 1.1e-05
sonic hedgehog group medulloblastoma -2.500 8.4e-05
atypical teratoid / rhabdoid tumor -2.100 1.4e-03
medulloblastoma, large-cell -2.000 9.2e-03
adult high grade glioma -1.700 1.5e-03
pilocytic astrocytoma -1.600 2.0e-05
lung carcinoma 2.200 4.2e-21
ovarian cancer 1.100 2.4e-03
pituitary cancer -2.100 1.0e-09
psoriasis 1.600 5.3e-42

Gene RIF (12)

PMID Text
22260995 found endogenous expression of the long form of the enzyme in human tissue, predominantly in the trans-Golgi network of endothelial cells that form human high endothelial venules.
21880669 Epitope expressing changes with suppression or over-expression of the Gal6ST (Gal 6-O-sulfotransferase) gene, suggesting that Gal6ST is involved in the biosynthesis of the unique epitopes of KL-6/mAb.
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of carbohydrate (keratan sulfate Gal-6) sulfotransferase 1 (CHST1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18854154 Knockdown of carbohydrate (keratan sulfate Gal-6) sulfotransferase 1 (CHST1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18698629 A new point mutation in C6ST-1 is associated with spondyloepiphyseal dysplasia, Omani type.
17690104 sulfated keratan sulfate is produced by beta3GNT7, beta4GalT4, CGn6ST, and KSG6ST
16495484 The first to identify upregulated CHST1 protein gene expression correlating with the motility of Schwann cells that guide growing axons through both developmental and injured environments.
15324304 C4ST-1 and C6ST-1 differ from each other in the recognition of uronic acid residues adjacent to the targeted GalNAc residue
8419650 Sulfate is linked to the carbohydrate chains of HIV-1 glycoproteins gp160, gp120, and gp41 during the endoplasmic reticulum to Golgi transport of the glycoproteins
1433500 Sulfate is linked to the carbohydrate chains of HIV-1 glycoproteins gp160, gp120, and gp41 during the endoplasmic reticulum to Golgi transport of the glycoproteins

AA Sequence

MQCSWKAVLLLALASIAIQYTAIRTFTAKSFHTCPGLAEAGLAERLCEESPTFAYNLSRKTHILILATTR      1 - 70
SGSSFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDLLRSLYDCDLYFLENYIK     71 - 140
PPPVNHTTDRIFRRGASRVLCSRPVCDPPGPADLVLEEGDCVRKCGLLNLTVAAEACRERSHVAIKTVRV    141 - 210
PEVNDLRALVEDPRLNLKVIQLVRDPRGILASRSETFRDTYRLWRLWYGTGRKPYNLDVTQLTTVCEDFS    211 - 280
NSVSTGLMRPPWLKGKYMLVRYEDLARNPMKKTEEIYGFLGIPLDSHVARWIQNNTRGDPTLGKHKYGTV    281 - 350
RNSAATAEKWRFRLSYDIVAFAQNACQQVLAQLGYKIAASEEELKNPSVSLVEERDFRPFS             351 - 411
//

Text Mined References (20)

PMID Year Title
22260995 2012 Expression of long-form N-acetylglucosamine-6-O-sulfotransferase 1 in human high endothelial venules.
21880669 2012 Novel O-linked glycans containing 6'-sulfo-Gal/GalNAc of MUC1 secreted from human breast cancer YMB-S cells: possible carbohydrate epitopes of KL-6(MUC1) monoclonal antibody.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
18698629 2008 Spondyloepiphyseal dysplasia, Omani type: further definition of the phenotype.
17690104 2007 Enzymes responsible for synthesis of corneal keratan sulfate glycosaminoglycans.
16495484 2006 Upregulation of chondroitin 6-sulphotransferase-1 facilitates Schwann cell migration during axonal growth.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324304 2004 Chondroitin 4-sulphotransferase-1 and chondroitin 6-sulphotransferase-1 are affected differently by uronic acid residues neighbouring the acceptor GalNAc residues.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11310842 2001 CHST1 and CHST2 sulfotransferase expression by vascular endothelial cells regulates shear-resistant leukocyte rolling via L-selectin.
10642612 2000 Sulfation of sialyl N-acetyllactosamine oligosaccharides and fetuin oligosaccharides by keratan sulfate Gal-6-sulfotransferase.
10528213 1999 L-selectin ligands expressed by human leukocytes are HECA-452 antibody-defined carbohydrate epitopes preferentially displayed by P-selectin glycoprotein ligand-1.
10330415 1999 Sulfotransferases of two specificities function in the reconstitution of high endothelial cell ligands for L-selectin.
10049591 1999 CHST1 and CHST2 sulfotransferases expressed by human vascular endothelial cells: cDNA cloning, expression, and chromosomal localization.
9639683 1998 Human chondroitin 6-sulfotransferase: cloning, gene structure, and chromosomal localization.
9405439 1997 Molecular cloning and characterization of human keratan sulfate Gal-6-sulfotransferase.
9117134 1996 Atherosclerosis: cell biology and lipoproteins.