Property Summary

NCBI Gene PubMed Count 54
PubMed Score 18.49
PubTator Score 23.40

Knowledge Summary

Patent (1,106)

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (44)

PMID Text
26318101 Data provide evidence that the protective genetic variant at rs6474413 identified in human genetic studies reduces gene expression and that decreased beta3 gene expression in mice reduces nicotine intake
25823894 Polymorphism in CHRNB3 gene is associated with esophageal adenocarcinoma.
25068303 Data show efficient expression of (alpha6beta2)2beta3 nicotinic acetylcholine receptors (AChRs) in Xenopus oocytes using free subunits with only small changes in alpha6 subunits, while not altering AChR pharmacology or channel structure.
24792900 these results demonstrate that the combined effect of rs6474412-C/T polymorphism in smoking-related CHRNB3-CHRNA6 region gene and smoking behavior may not confer risk to psoriasis vulgaris (PV), but may have impact on PV severity in Chinese Han population.
24731518 CHRNB3 c.-57A>G alteration affects the promoter activity and is associated with Parkinson's disease (PD), and smoking in PD patients.
24675634 the CHRNB3-A6 locus contains multiple variants affecting risk for vulnerability to cocaine and nicotine dependence as well as bipolar disorder, suggesting that they have pleiotropic effects.
24401102 The common variant rs13273442 in the CHRNB3-CHNRA6 region is associated significantly with nicotine dependence in European Americans and African Americans.
24057674 Rare missense variants in CHRNB3 and CHRNA3 are associated with risk of alcohol and cocaine dependence.
24001015 This patient's chromosomal abnormality affected only one gene that is highly expressed in the brainstem and brain, involved in neurotransmission, and could be related to her Duane retraction syndrome.
23943838 Level of cigarettes per day during adolescence and young adulthood is associated with CHRNB3A6, CHRNA5A3B4, and CHRNA2
23899432 Results demonstrate the association between SNPs in CHRNB3 nicotinic acetylcholine receptor genes and the risk of smoking in ADHD
23319001 this study provides convincing evidence for a role of CHRNB3 in Nicotine Dependence.
22524403 The results indicate the genetic locus for the CHRNB3 gene is strongly associated with nicotine dependence.
22315221 beta3 subunit coexpression promotes function of alpha6*-nAChR
21831805 CHRNB3 and CHRNA6 polymorphisms are associated with smoking behavior and lung cancer susceptibility in Chinese Han population.
21606657 The GG genotype of SNP rs13261190 in the CHRNB3 was associated with increased novelty seeking in alcohol-dependent individuals.
21191315 Variants in CHRNB3/CHRNA6 are independently associated with bipolar disorder.
20923852 Concatameric pentamers and pentamers formed from combinations of trimers, dimers, and monomers of alpha6beta2beta3* acetylcholine receptors exhibit similar properties, indicating that the linkers between subunits do not alter their functional properties.
20854418 Observational study of gene-disease association. (HuGE Navigator)
20840187 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20736995 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20584212 Observational study of gene-disease association. (HuGE Navigator)
20418888 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20418888 CHRNB3-CHRNA6 and CYP2A6 sequence variants affect smoking behavior
20231857 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19760673 Observational study of gene-disease association. (HuGE Navigator)
19500157 Three single nucleotide polymorphisms (SNPs) in CHRNA6 and one SNP in CHRNB3 are associated with a composite of alcohol phenotypes.
19500157 Observational study of gene-disease association. (HuGE Navigator)
19482438 There was no evidence of association of any of the SNPs in CHRNAB2 (rs2072661, rs4845378) or CHRNAB3 (rs4953, rs6474413) with smoking status (p=0.30) or, among daily smokers, of association with cotinine levels (p=0.08).
19482438 Observational study of gene-disease association. (HuGE Navigator)
19259974 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18704094 Together these results further implicate the region downstream of CHRNA6 and the region upstream of CHRNB3 in risk of nicotine dependence.
18704094 Observational study of gene-disease association. (HuGE Navigator)
18055561 CHRNB3 is associated with subjective responses to tobacco.
18055561 Observational study of gene-disease association. (HuGE Navigator)
17559419 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17373692 Observational study of gene-disease association. (HuGE Navigator)
17158188 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17135278 Observational study of gene-disease association. (HuGE Navigator)
16314871 Observational study of gene-disease association. (HuGE Navigator)
12912995 absence of differences in the pharmacological profile of nicotinic receptor alpha3beta4 argues against role for incorporated beta3 subunit in formation of agonist binding sites while changes in channel kinetics suggest important effect on receptor gating

AA Sequence

MLPDFMLVLIVLGIPSSATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDE      1 - 70
KNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGT     71 - 140
VVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMK    141 - 210
GNRRDGVYSYPFITYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLL    211 - 280
VIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMK    281 - 350
DHVDRYSSPEKEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWK    351 - 420
FVAQVLDRIFLWLFLIVSVTGSVLIFTPALKMWLHSYH                                    421 - 458
//

Text Mined References (54)

PMID Year Title
26318101 2015 The ?3 subunit of the nicotinic acetylcholine receptor: Modulation of gene expression and nicotine consumption.
25823894 2015 A genetic variant in CHRNB3-CHRNA6 increases risk of esophageal squamous cell carcinoma in Chinese populations.
25068303 2014 Efficient expression of functional (?6?2)2?3 AChRs in Xenopus oocytes from free subunits using slightly modified ?6 subunits.
24792900 2014 Combined effect between CHRNB3-CHRNA6 region gene variant (rs6474412) and smoking in psoriasis vulgaris severity.
24731518 2014 CHRNB3 c.-57A>G functional promoter change affects Parkinson's disease and smoking.
24675634 2014 Variants near CHRNB3-CHRNA6 are associated with DSM-5 cocaine use disorder: evidence for pleiotropy.
24401102 2014 Multiple distinct CHRNB3-CHRNA6 variants are genetic risk factors for nicotine dependence in African Americans and European Americans.
24057674 2014 Rare missense variants in CHRNB3 and CHRNA3 are associated with risk of alcohol and cocaine dependence.
24001015 2015 Nicotinic Receptor Mutation in a Mildly Dysmorphic Girl with Duane Retraction Syndrome.
23943838 2014 Effect of neuronal nicotinic acetylcholine receptor genes (CHRN) on longitudinal cigarettes per day in adolescents and young adults.
23899432 2013 Nicotinic receptor gene variants interact with attention deficient hyperactive disorder symptoms to predict smoking trajectories from early adolescence to adulthood.
23319001 2013 Significant association of CHRNB3 variants with nicotine dependence in multiple ethnic populations.
22524403 2012 CHRNB3 is more strongly associated with Fagerström test for cigarette dependence-based nicotine dependence than cigarettes per day: phenotype definition changes genome-wide association studies results.
22315221 2012 Modulation of gain-of-function ?6*-nicotinic acetylcholine receptor by ?3 subunits.
21831805 2011 [Human chromosome 8p11 (CHRNB3-CHRNA6) region gene polymorphisms and susceptibility to lung cancer in Chinese Han population].
21606657 2011 Reward-related genes and personality traits in alcohol-dependent individuals: a pilot case control study.
21191315 2011 Genetic association of bipolar disorder with the ?(3) nicotinic receptor subunit gene.
20923852 2011 Expression of functional human ?6?2?3* acetylcholine receptors in Xenopus laevis oocytes achieved through subunit chimeras and concatamers.
20854418 2011 CHRNB2 promoter region: association with subjective effects to nicotine and gene expression differences.
20840187 2010 Peer smoking and the nicotinic receptor genes: an examination of genetic and environmental risks for nicotine dependence.
20736995 2010 Resequencing of nicotinic acetylcholine receptor genes and association of common and rare variants with the Fagerström test for nicotine dependence.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20584212 2010 Multiple cholinergic nicotinic receptor genes affect nicotine dependence risk in African and European Americans.
20418888 2010 Sequence variants at CHRNB3-CHRNA6 and CYP2A6 affect smoking behavior.
20231857 2011 Why do young women smoke? VI. A controlled study of nicotine effects on attention: pharmacogenetic interactions.
19760673 2010 Association of CHRN genes with "dizziness" to tobacco.
19500157 2009 SNPs in CHRNA6 and CHRNB3 are associated with alcohol consumption in a nationally representative sample.
19482438 2009 Association of genes coding for the alpha-4, alpha-5, beta-2 and beta-3 subunits of nicotinic receptors with cigarette smoking and nicotine dependence.
19259974 2009 Multiple distinct risk loci for nicotine dependence identified by dense coverage of the complete family of nicotinic receptor subunit (CHRN) genes.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19059502 2009 Design and expression of human alpha7 nicotinic acetylcholine receptor extracellular domain mutants with enhanced solubility and ligand-binding properties.
18704094 2009 Genetic association of the CHRNA6 and CHRNB3 genes with tobacco dependence in a nationally representative sample.
18055561 2008 The neuronal nicotinic receptor subunit genes (CHRNA6 and CHRNB3) are associated with subjective responses to tobacco.
17559419 2008 Why do young women smoke? V. Role of direct and interactive effects of nicotinic cholinergic receptor gene variation on neurocognitive function.
17373692 2007 No evidence for association between 19 cholinergic genes and bipolar disorder.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17158188 2007 Novel genes identified in a high-density genome wide association study for nicotine dependence.
17135278 2007 Cholinergic nicotinic receptor genes implicated in a nicotine dependence association study targeting 348 candidate genes with 3713 SNPs.
16314871 2006 Why do young women smoke? I. Direct and interactive effects of environment, psychological characteristics and nicotinic cholinergic receptor genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12912995 2003 The effects of beta3 subunit incorporation on the pharmacology and single channel properties of oocyte-expressed human alpha3beta4 neuronal nicotinic receptors.
12783266 2003 Nicotinic acetylcholine receptors: from structure to brain function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11118490 2000 Stoichiometry of human recombinant neuronal nicotinic receptors containing the b3 subunit expressed in Xenopus oocytes.
10336173 1999 Diversity of mRNA expression for muscarinic acetylcholine receptor subtypes and neuronal nicotinic acetylcholine receptor subunits in human mononuclear leukocytes and leukemic cell lines.
9624109 1998 A reporter mutation approach shows incorporation of the "orphan" subunit beta3 into a functional nicotinic receptor.
9193799 1997 Expression of the alpha 7 subunit of the nicotinic acetylcholine receptor in normal and myasthenic human thymuses.
9009220 1997 Cloning and sequence of full-length cDNAs encoding the human neuronal nicotinic acetylcholine receptor (nAChR) subunits beta3 and beta4 and expression of seven nAChR subunits in the human neuroblastoma cell line SH-SY5Y and/or IMR-32.
8906617 1996 Comparative structure of human neuronal alpha 2-alpha 7 and beta 2-beta 4 nicotinic acetylcholine receptor subunits and functional expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and beta 4 subunits.
8088849 1994 Mapping of the human nicotinic acetylcholine receptor beta 3 gene (CHRNB3) within chromosome 8p11.2.
7690916 1993 Molecular cloning of a human neuronal nicotinic acetylcholine receptor beta 3-like subunit.
7571003 1995 Ion-channel assembly.
1505988 1992 Chromosomal localization of seven neuronal nicotinic acetylcholine receptor subunit genes in humans.