Property Summary

NCBI Gene PubMed Count 49
PubMed Score 13.46
PubTator Score 16.09

Knowledge Summary

Patent (428)

 MGI Phenotype (1)

Protein-protein Interaction (6)

Gene RIF (39)

PMID Text
25823894 Polymorphism in CHRNA6 gene is associated with esophageal adenocarcinoma.
25068303 Data show efficient expression of (alpha6beta2)2beta3 nicotinic acetylcholine receptors (AChRs) in Xenopus oocytes using free subunits with only small changes in alpha6 subunits, while not altering AChR pharmacology or channel structure.
24886653 N-terminal alpha-helix (Asp57); complementary face/inner beta-fold (Arg87 or Asp92) and principal face/outer beta-fold (Ser156 or Asn171) residues in the halpha6 subunit are crucial for functional expression.
24792900 these results demonstrate that the combined effect of rs6474412-C/T polymorphism in smoking-related CHRNB3-CHRNA6 region gene and smoking behavior may not confer risk to psoriasis vulgaris (PV), but may have impact on PV severity in Chinese Han population.
24675634 the CHRNB3-A6 locus contains multiple variants affecting risk for vulnerability to cocaine and nicotine dependence as well as bipolar disorder, suggesting that they have pleiotropic effects.
24401102 The common variant rs13273442 in the CHRNB3-CHNRA6 region is associated significantly with nicotine dependence in European Americans and African Americans.
24253422 findings indicate that both CHRNA2 and CHRNA6 play a significant role in the etiology of ND in AA and EA smokers
24085295 Elucidation of molecular impediments in the alpha6 subunit for in vitro expression of functional alpha6beta4* nicotinic acetylcholine receptors.
23899432 Results demonstrate the association between SNPs in CHRNA6 nicotinic acetylcholine receptor genes and the risk of smoking in ADHD
23227187 Cross sectional data of US adults from the NHANES linked with genotype and geocodes were used to identify tobacco use phenotypes, state-level taxation rates, and variation in the nicotinic acetylcholine receptor (CHRNA6) genotype
23002780 Chrna6 has a cellular expression signature for retinal ganglion cells with high correlation to Thy1, a known marker. Immunofluorescence confirms this gene is preferentially expressed by RGCs in the young and adult mouse retina and expression is reduced in glaucoma.
22315221 beta3 subunit coexpression promotes function of alpha6*-nAChR
21917987 alpha6beta4* nAChRs are expressed and contribute to exocytosis in human chromaffin cells of the adrenal gland, the main source of adrenaline under stressful situations.
21873428 analysis of how nicotinic acetylcholine receptor (nAChR) alpha5 subunits and/or variants modulate function of alpha6*-nAChR
21832048 analysis of N-terminal extracellular domain determinants in nicotinic acetylcholine receptor (nAChR) alpha6 subunits that influence effects of wild-type or mutant beta3 subunits on function of alpha6beta2*- or alpha6beta4*-nAChR
21831805 CHRNB3 and CHRNA6 polymorphisms are associated with smoking behavior and lung cancer susceptibility in Chinese Han population.
20923852 Concatameric pentamers and pentamers formed from combinations of trimers, dimers, and monomers of alpha6beta2beta3* acetylcholine receptors exhibit similar properties, indicating that the linkers between subunits do not alter their functional properties.
20854418 Observational study of gene-disease association. (HuGE Navigator)
20736995 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20584212 Observational study of gene-disease association. (HuGE Navigator)
20418888 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20418888 CHRNB3-CHRNA6 and CYP2A6 sequence variants affect smoking behavior
20231857 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20029407 The negative consequences of Prenatal exposure to maternal cigarette smoking on the brain and behavior of adolescence and suggestion that the alpha6 nAChR subunit may modify, at least in part, these effects.
20029407 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19698703 present findings disclose a haplotype association between the CHRNA6 gene and heavy alcohol use as well as an association of the CHRNA4 gene with increased body mass in heavy consumers of alcohol
19500157 Three single nucleotide polymorphisms (SNPs) in CHRNA6 and one SNP in CHRNB3 are associated with a composite of alcohol phenotypes.
19500157 Observational study of gene-disease association. (HuGE Navigator)
19259974 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18940593 Activating transgenic gain-of-function alpha 6 nicotinic receptors in dopamine neurons is sufficient to cause locomotor hyperactivity.
18940582 Alpha6 subunit-containing nicotinic receptors play a selective role in the modulation of dopamine release in both the nucleus accumbens and in the dorsal striatum.
18704094 Together these results further implicate the region downstream of CHRNA6 and the region upstream of CHRNB3 in risk of nicotine dependence.
18704094 Observational study of gene-disease association. (HuGE Navigator)
18055561 CHRNA6 is associated with subjective responses to tobacco.
18055561 Observational study of gene-disease association. (HuGE Navigator)
17373692 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVTVHFEVAITQL      1 - 70
ANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALL     71 - 140
KYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIID    141 - 210
ASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLL    211 - 280
SLTVFLLVITETIPSTSLVVPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLP    281 - 350
QVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVV    351 - 420
ENSEHSPEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTAGLFLQPLLGN    421 - 490
TGKS                                                                      491 - 494
//

Text Mined References (51)

PMID Year Title
25823894 2015 A genetic variant in CHRNB3-CHRNA6 increases risk of esophageal squamous cell carcinoma in Chinese populations.
25068303 2014 Efficient expression of functional (?6?2)2?3 AChRs in Xenopus oocytes from free subunits using slightly modified ?6 subunits.
24886653 2014 Analysis of rare variations reveals roles of amino acid residues in the N-terminal extracellular domain of nicotinic acetylcholine receptor (nAChR) alpha6 subunit in the functional expression of human alpha6*-nAChRs.
24792900 2014 Combined effect between CHRNB3-CHRNA6 region gene variant (rs6474412) and smoking in psoriasis vulgaris severity.
24675634 2014 Variants near CHRNB3-CHRNA6 are associated with DSM-5 cocaine use disorder: evidence for pleiotropy.
24401102 2014 Multiple distinct CHRNB3-CHRNA6 variants are genetic risk factors for nicotine dependence in African Americans and European Americans.
24253422 2014 Significant associations of CHRNA2 and CHRNA6 with nicotine dependence in European American and African American populations.
24085295 2013 Elucidation of molecular impediments in the ?6 subunit for in vitro expression of functional ?6?4* nicotinic acetylcholine receptors.
23899432 2013 Nicotinic receptor gene variants interact with attention deficient hyperactive disorder symptoms to predict smoking trajectories from early adolescence to adulthood.
23227187 2012 Why have tobacco control policies stalled? Using genetic moderation to examine policy impacts.
23002780 2013 Effects of glaucoma on Chrna6 expression in the retina.
22315221 2012 Modulation of gain-of-function ?6*-nicotinic acetylcholine receptor by ?3 subunits.
21917987 2012 Native ?6?4* nicotinic receptors control exocytosis in human chromaffin cells of the adrenal gland.
21873428 2011 Reporter mutation studies show that nicotinic acetylcholine receptor (nAChR) ?5 Subunits and/or variants modulate function of ?6*-nAChR.
21832048 2011 Identification of N-terminal extracellular domain determinants in nicotinic acetylcholine receptor (nAChR) ?6 subunits that influence effects of wild-type or mutant ?3 subunits on function of ?6?2*- or ?6?4*-nAChR.
21831805 2011 [Human chromosome 8p11 (CHRNB3-CHRNA6) region gene polymorphisms and susceptibility to lung cancer in Chinese Han population].
20923852 2011 Expression of functional human ?6?2?3* acetylcholine receptors in Xenopus laevis oocytes achieved through subunit chimeras and concatamers.
20854418 2011 CHRNB2 promoter region: association with subjective effects to nicotine and gene expression differences.
20736995 2010 Resequencing of nicotinic acetylcholine receptor genes and association of common and rare variants with the Fagerström test for nicotine dependence.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20584212 2010 Multiple cholinergic nicotinic receptor genes affect nicotine dependence risk in African and European Americans.
20418888 2010 Sequence variants at CHRNB3-CHRNA6 and CYP2A6 affect smoking behavior.
20231857 2011 Why do young women smoke? VI. A controlled study of nicotine effects on attention: pharmacogenetic interactions.
20029407 2010 Prenatal exposure to maternal cigarette smoking interacts with a polymorphism in the alpha6 nicotinic acetylcholine receptor gene to influence drug use and striatum volume in adolescence.
19698703 2009 Association of nAChR gene haplotypes with heavy alcohol use and body mass.
19564872 2009 Differential contribution of genetic variation in multiple brain nicotinic cholinergic receptors to nicotine dependence: recent progress and emerging open questions.
19500157 2009 SNPs in CHRNA6 and CHRNB3 are associated with alcohol consumption in a nationally representative sample.
19259974 2009 Multiple distinct risk loci for nicotine dependence identified by dense coverage of the complete family of nicotinic receptor subunit (CHRN) genes.
19204725 2009 Chromosome 8p as a potential hub for developmental neuropsychiatric disorders: implications for schizophrenia, autism and cancer.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19059502 2009 Design and expression of human alpha7 nicotinic acetylcholine receptor extracellular domain mutants with enhanced solubility and ligand-binding properties.
18940593 2008 In vivo activation of midbrain dopamine neurons via sensitized, high-affinity alpha 6 nicotinic acetylcholine receptors.
18940582 2008 ACh/dopamine crosstalk in motor control and reward: a crucial role for alpha 6-containing nicotinic receptors?
18704094 2009 Genetic association of the CHRNA6 and CHRNB3 genes with tobacco dependence in a nationally representative sample.
18198416 2007 Comparison analysis of gene expression patterns between sporadic Alzheimer's and Parkinson's disease.
18055561 2008 The neuronal nicotinic receptor subunit genes (CHRNA6 and CHRNB3) are associated with subjective responses to tobacco.
17373692 2007 No evidence for association between 19 cholinergic genes and bipolar disorder.
17324557 2007 Further evidence of genetic heterogeneity in families with autosomal dominant nocturnal frontal lobe epilepsy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12537063 2003 Nicotinic cholinergic receptor expression in the human nasal mucosa.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12406580 2002 Genomic organization and promoter analysis of the human nicotinic acetylcholine receptor alpha6 subunit (CHNRA6) gene: Alu and other elements direct transcriptional repression.
12195439 2002 Exclusion of linkage of nine neuronal nicotinic acetylcholine receptor subunit genes expressed in brain in autosomal dominant nocturnal frontal lobe epilepsy in four unrelated families.
12150770 2002 Immunohistochemical localisation of nicotinic acetylcholine receptor subunits in human cerebellum.
8950106 1996 Neuronal nicotinic receptor alpha 6 subunit mRNA is selectively concentrated in catecholaminergic nuclei of the rat brain.
8906617 1996 Comparative structure of human neuronal alpha 2-alpha 7 and beta 2-beta 4 nicotinic acetylcholine receptor subunits and functional expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and beta 4 subunits.