Property Summary

Ligand Count 170
NCBI Gene PubMed Count 184
PubMed Score 4263.66
PubTator Score 1723.69

Knowledge Summary

Patent (65,374)

TINX Plot

  Disease (8)

Disease Target Count P-value
psoriasis 6694 2.7e-17
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Autosomal dominant nocturnal frontal lobe epilepsy 4 0.0 5.0
Disease Target Count
Frontal lobe epilepsy 10

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.000 2.7e-17

Protein-protein Interaction (1)

Gene RIF (180)

AA Sequence

MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSI      1 - 70
AQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTK     71 - 140
AHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWV    141 - 210
IVDAVGTYNTRKYECCAEIYPDITYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCIS    211 - 280
VLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLD    281 - 350
IVPRLLLMKRPSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGP    351 - 420
SCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGGVRCRSRSIQ    421 - 490
YCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPL    491 - 560
SPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAGMI       561 - 627
//

Text Mined References (186)

PMID Year Title