Property Summary

Ligand Count 265
NCBI Gene PubMed Count 39
PubMed Score 79.80
PubTator Score 43.75

Knowledge Summary

Patent (3,051)

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.200 2.1e-03
osteosarcoma 1.646 2.0e-07
psoriasis -4.000 1.0e-132

Gene RIF (16)

AA Sequence

MANFTPVNGSSGNQSVRLVTSSSHNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNRQLQTVNNYF      1 - 70
LFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTY     71 - 140
PARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVPDNQCFIQFLSNPAVTFGTAIAAFYLPVVI    141 - 210
MTVLYIHISLASRSRVHKHRPEGPKEKKAKTLAFLKSPLMKQSVKKPPPGEAAREELRNGKLEEAPPPAL    211 - 280
PPPPRPVADKDTSNESSSGSATQNTKERPATELSTTEATTPAMPAPPLQPRALNPASRWSKIQIVTKQTG    281 - 350
NECVTAIEIVPATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMV    351 - 420
LVNTFCQSCIPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR               421 - 479
//

Text Mined References (39)

PMID Year Title