Property Summary

NCBI Gene PubMed Count 42
PubMed Score 56.52
PubTator Score 124.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
astrocytic glioma -2.500 8.2e-03
esophageal adenocarcinoma 1.200 3.6e-02
glioblastoma -3.800 1.2e-06
oligodendroglioma -1.500 7.3e-09
osteosarcoma 1.815 6.6e-03
ependymoma -2.800 9.4e-11
atypical teratoid / rhabdoid tumor -4.300 4.6e-07
medulloblastoma, large-cell 1.900 3.8e-02
pancreatic ductal adenocarcinoma liver m... -2.236 2.1e-03
non-small cell lung cancer -1.210 3.3e-09
lung cancer 2.300 8.1e-04
pediatric high grade glioma -3.500 1.1e-08
sonic hedgehog group medulloblastoma -3.000 1.7e-04
pilocytic astrocytoma -2.900 6.3e-07
subependymal giant cell astrocytoma -3.655 4.6e-03
lung carcinoma 3.100 3.5e-43
Breast cancer 1.200 9.4e-03
ulcerative colitis -1.500 3.8e-05
ovarian cancer -3.300 1.8e-10
pituitary cancer -1.200 7.4e-03
chronic rhinosinusitis -1.251 8.7e-03
cystic fibrosis and chronic rhinosinusit... -1.170 1.3e-02
pancreatic cancer -1.200 8.2e-03

Gene RIF (21)

PMID Text
26315110 CHN2 is consistently hypermethylated and downregulated in small bowel adenocarcinoma with diagnostic potential
25057852 CHN2, ABCB1 and PPP1R9A expression on chromosome 7 is implicated in the pathogenesis of hepatosplenic T-cell lymphoma distinguishing it from other malignancies.
24854763 genetic association studies in a population in Taiwan: Data suggest that an SNP in CHN2 (rs1002630) is associated with non-proliferative diabetic retinopathy in patients with diabetes type 2 in the Han Chinese population studied.
23941981 A significant association of the novel rs186911567 polymorphism was found for the CHN2 gene with smoking.
21911749 genetic association studies in a Chinese population with type 2 diabetes: An SNP in CHN2 (rs39059) is associated with diabetic retinopathy in a Chinese population of type 2 diabetic patients.
20818722 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20602751 Observational study of gene-disease association. (HuGE Navigator)
20460425 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20335173 the Rac-GAP beta2-chimaerin is negatively regulated by protein kinase Cdelta-mediated phosphorylation
19911011 Observational study of gene-disease association. (HuGE Navigator)
19720790 Likely digenic cause of insulin resistance and growth deficiency resulting from the combined heterozygous disruption of INSR and CHN2, implicating CHN2 for the first time as a key element of proximal insulin signaling in vivo.
19306875 results suggest that beta2-chimaerin is activated by EphA receptors and mediates the EphA receptor-dependent regulation of cell migration
19201754 Tyr-153 is the Lck-dependent phosphorylation residue and its phosphorylation negatively regulates membrane stabilization of beta2-chimaerin, decreasing its GAP activity to Rac
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18249095 Identify chimaerins as candidates for the downmodulation of Rac1 in T-lymphocytes and, in addition, uncover a novel regulatory mechanism that mediates their activation in T-cells.
17803461 the interaction of diacylglycerol kinase gamma with the Src homology 2 and C1 domains of beta2-chimaerin is induced synergistically by Phorbol ester and hydrogen peroxide
17560670 results suggest Tyr-21 phosphorylation of beta2-chimaerin as a novel, Src-family kinase-dependent mechanism that negatively regulates beta2-chimaerin Rac-GAP activity
16525710 Beta2-chimaerin regulates the proliferation and migration of vascular smooth muscle cells downstream of growth factor signaling pathway implicating human atherogenesis.
16352660 Data demonstrate that beta2-chimaerin provides a novel, diacylglycerol-dependent mechanism for Rac regulation in T cells and suggest a functional role for this protein in Rac-mediated cytoskeletal remodeling.
15863513 beta 2 chimerin has a role in rac-GAP-dependent inhibition of breast cancer cell proliferation

AA Sequence

MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREFHGIISREQAD      1 - 70
ELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRFESIHDLVTDGLITLYIETKA     71 - 140
AEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKTNVTHEEHTAVEKISSLVRRAALTHNDNHFN    141 - 210
YEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLT    211 - 280
TLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITG    281 - 350
ALKLYFRDLPIPVITYDTYSKFIDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDN    351 - 420
FMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF                          421 - 468
//

Text Mined References (42)

PMID Year Title
26315110 2015 Comprehensive molecular pathology analysis of small bowel adenocarcinoma reveals novel targets with potential for clinical utility.
25057852 2014 Integrative genomic and transcriptomic analysis identified candidate genes implicated in the pathogenesis of hepatosplenic T-cell lymphoma.
24854763 Chimerin 2 genetic polymorphisms are associated with non-proliferative diabetic retinopathy in Taiwanese type 2 diabetic patients.
24132900 2013 Genome-wide association study of atypical psychosis.
23941981 2013 Association of a novel polymorphism of the ?2-chimaerin gene (CHN2) with smoking.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21911749 2011 CPVL/CHN2 genetic variant is associated with diabetic retinopathy in Chinese type 2 diabetic patients.
20818722 2010 A Bayesian approach to genetic association studies with family-based designs.
20602751 2010 Generalist genes analysis of DNA markers associated with mathematical ability and disability reveals shared influence across ages and abilities.
20460425 2010 Replication study for the association between four Loci identified by a genome-wide association study on European American subjects with type 1 diabetes and susceptibility to diabetic nephropathy in Japanese subjects with type 2 diabetes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20335173 2010 A novel cross-talk in diacylglycerol signaling: the Rac-GAP beta2-chimaerin is negatively regulated by protein kinase Cdelta-mediated phosphorylation.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19720790 2009 Severe insulin resistance and intrauterine growth deficiency associated with haploinsufficiency for INSR and CHN2: new insights into synergistic pathways involved in growth and metabolism.
19306875 2009 Beta2-chimaerin binds to EphA receptors and regulates cell migration.
19201754 2009 T cell receptor-dependent tyrosine phosphorylation of beta2-chimaerin modulates its Rac-GAP function in T cells.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18249095 2008 Role of chimaerins, a group of Rac-specific GTPase activating proteins, in T-cell receptor signaling.
17803461 2008 Phorbol ester and hydrogen peroxide synergistically induce the interaction of diacylglycerol kinase gamma with the Src homology 2 and C1 domains of beta2-chimaerin.
17560670 2007 Tyrosine phosphorylation of beta2-chimaerin by Src-family kinase negatively regulates its Rac-specific GAP activity.
16628218 2006 Phospholipase Cgamma/diacylglycerol-dependent activation of beta2-chimaerin restricts EGF-induced Rac signaling.
16525710 2006 Regulation of vascular smooth muscle proliferation and migration by beta2-chimaerin, a non-protein kinase C phorbol ester receptor.
16428439 2006 Essential role for Rac in heregulin beta1 mitogenic signaling: a mechanism that involves epidermal growth factor receptor and is independent of ErbB4.
16352660 2006 Beta2-chimaerin provides a diacylglycerol-dependent mechanism for regulation of adhesion and chemotaxis of T cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15863513 2005 Rac-GAP-dependent inhibition of breast cancer cell proliferation by {beta}2-chimerin.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15653288 2005 A missense polymorphism (H204R) of a Rho GTPase-activating protein, the chimerin 2 gene, is associated with schizophrenia in men.
15507211 2004 Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12877655 2003 Characterization of the Rac-GAP (Rac-GTPase-activating protein) activity of beta2-chimaerin, a 'non-protein kinase C' phorbol ester receptor.
12853948 2003 The DNA sequence of human chromosome 7.
12716467 2002 Microarray analysis of gene-expression profiles in diffuse large B-cell lymphoma: identification of genes related to disease progression.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11689559 2002 Chimaerins, novel non-protein kinase C phorbol ester receptors, associate with Tmp21-I (p23): evidence for a novel anchoring mechanism involving the chimaerin C1 domain.
11278894 2001 Phorbol esters and related analogs regulate the subcellular localization of beta 2-chimaerin, a non-protein kinase C phorbol ester receptor.
10518540 1999 beta2-chimaerin is a novel target for diacylglycerol: binding properties and changes in subcellular localization mediated by ligand binding to its C1 domain.
9334226 1997 Beta2-chimaerin is a high affinity receptor for the phorbol ester tumor promoters.
8175705 1994 Cerebellar beta 2-chimaerin, a GTPase-activating protein for p21 ras-related rac is specifically expressed in granule cells and has a unique N-terminal SH2 domain.
7614486 1995 Identification and characterization of human beta 2-chimaerin: association with malignant transformation in astrocytoma.