Property Summary

NCBI Gene PubMed Count 35
PubMed Score 21.42
PubTator Score 15.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.059 1.2e-03
juvenile dermatomyositis 1.364 4.3e-09
intraductal papillary-mucinous neoplasm ... 1.400 2.5e-02
diabetes mellitus -1.100 1.0e-03
Multiple Sclerosis 1.100 1.3e-02
primary Sjogren syndrome 1.100 3.7e-03
dermatomyositis 1.200 1.7e-02

Gene RIF (7)

PMID Text
26821576 CHMP5 might be involved in the homeostatic regulation of TCR on the cell surface, presumably through TCR recycling or degradation. Thus CHMP5 is implicated in TCR-mediated signaling.
25637630 ESCRT-III protein CHMP5 inhibits LIP5-mediated VPS4 activation by inducing a moderate conformational change within LIP5.
23619569 after CHMP5 inhibition, both Granzyme B/Perforin apoptotic pathway and apoptosis-inducing factor-mediated necrotic pathway were activated, while autophagic pathway was not activated
22082156 Knockdown of charged multivesicular body protein 5 (CHMP5) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
18426649 pnas-2 is specifically up-regulated in acute leukemia patients.
17855796 PNAS-2 was shown to be anti-apoptotic and may participate in leukemogenesis
17708794 The pnas-2 gene may be closely related with apotosis of arsenic sulfide treated APL cells.

AA Sequence

MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLK      1 - 70
QKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMME     71 - 140
DANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDE    141 - 210
FGLPQIPAS                                                                 211 - 219
//

Text Mined References (42)

PMID Year Title
26821576 2016 Charged MVB protein 5 is involved in T-cell receptor signaling.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25637630 2015 A novel mechanism of regulating the ATPase VPS4 by its cofactor LIP5 and the endosomal sorting complex required for transport (ESCRT)-III protein CHMP5.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23619569 2013 The role of charged multivesicular body protein 5 in programmed cell death in leukemic cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23105106 2012 Interactions of the human LIP5 regulatory protein with endosomal sorting complexes required for transport.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21543490 2011 Mechanism of inhibition of retrovirus release from cells by interferon-induced gene ISG15.
21269460 2011 Initial characterization of the human central proteome.
20932654 2010 Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer.
20616062 2010 Human ESCRT-III and VPS4 proteins are required for centrosome and spindle maintenance.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18426649 2008 [Expression spectra of apoptosis-related gene pnas-2].
18385515 2008 Novel interactions of ESCRT-III with LIP5 and VPS4 and their implications for ESCRT-III disassembly.
17855796 2006 PNAS-2: a novel gene probably participating in leukemogenesis.
17853893 2007 Human ESCRT and ALIX proteins interact with proteins of the midbody and function in cytokinesis.
17711858 2007 The MIT domain of UBPY constitutes a CHMP binding and endosomal localization signal required for efficient epidermal growth factor receptor degradation.
17708794 2007 [Correlation between expression of apoptosis-related gene pnas-2 and leukemia].
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17261583 2007 Targeting of AMSH to endosomes is required for epidermal growth factor receptor degradation.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15644320 2005 The role of LIP5 and CHMP5 in multivesicular body formation and HIV-1 budding in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14519844 2003 Divergent retroviral late-budding domains recruit vacuolar protein sorting factors by using alternative adaptor proteins.
14505570 2003 The protein network of HIV budding.
14505569 2003 AIP1/ALIX is a binding partner for HIV-1 p6 and EIAV p9 functioning in virus budding.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11559748 2001 CHMP1 functions as a member of a newly defined family of vesicle trafficking proteins.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.