Property Summary

NCBI Gene PubMed Count 33
PubMed Score 14.24
PubTator Score 16.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
PONTOCEREBELLAR HYPOPLASIA, TYPE 8 1
Disease Target Count P-value
osteosarcoma 7933 9.8e-09
psoriasis 6685 1.4e-04
Disease Target Count Z-score Confidence
Pontocerebellar hypoplasia 29 3.355 1.7
Disease Target Count Z-score Confidence
Neurodegenerative disease 383 0.0 4.0
Disease Target Count
pontocerebellar hypoplasia type 8 1
Disease Target Count
Pontocerebellar hypoplasia 8 1

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.400 1.4e-04
osteosarcoma -1.916 9.8e-09

Gene RIF (8)

PMID Text
23748770 we identified Ser(179) and Ser(182) located in the C-terminal region of the CHMP1A as major phosphorylation sites that cause a mobility shift.
23273016 Study reports the discovery of a chimeric RNA between ZC3HAV1L and CHMP1A in human, located on chromosome 7 and 16, respectively. The fusion occurs at an exon-exon boundary, and was detected both computationally and experimentally from different cells or tissue types.
23023333 Our results suggest that CHMP1A serves as a critical link between cytoplasmic signals and BMI1-mediated chromatin modifications that regulate proliferation of central nervous system progenitor cells.
22261332 our results demonstrate that Chmp1A functions as a tumor suppressor gene in renal cells
21705858 Chmp1A regulates tumor growth through ATM sugnaling and that neclear locaization of Chmp1A is reqired for the growth inhibition and ATM activation.
19640981 Both Vps4A and CHMP1A localized in the vicinity of viral cytoplasmic assembly compartments, sites of viral maturation that develop in Cytomegalovirus-infected cells. Thus, ESCRT machinery is involved in the final steps of HCMV replication.
18787405 Chmp1A is a novel tumor suppressor, especially in pancreas and that Chmp1A regulates tumor growth potentially through p53 signaling pathway.
17711858 UBPY MIT domain and another ubiquitin isopeptidase, AMSH, reveals common interactions with CHMP1A and CHMP1B but a distinct selectivity of AMSH for CHMP3/VPS24, a core subunit of the ESCRT-III complex, and UBPY for CHMP7.

AA Sequence

MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVD      1 - 70
AVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLT     71 - 140
TPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN                  141 - 196
//

Text Mined References (38)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23748770 2013 Identification of phosphorylation sites in the C-terminal region of charged multivesicular body protein 1A (CHMP1A).
23456168 2013 Genome-wide association study in Han Chinese identifies three novel loci for human height.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23273016 2012 Detection of a common chimeric transcript between human chromosomes 7 and 16.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23045692 2012 ESCRT-III binding protein MITD1 is involved in cytokinesis and has an unanticipated PLD fold that binds membranes.
23023333 2012 CHMP1A encodes an essential regulator of BMI1-INK4A in cerebellar development.
22261332 2012 Chmp1A acts as a tumor suppressor gene that inhibits proliferation of renal cell carcinoma.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21705858 2011 Chromatin modifying protein 1A (Chmp1A) of the endosomal sorting complex required for transport (ESCRT)-III family activates ataxia telangiectasia mutated (ATM) for PanC-1 cell growth inhibition.
21269460 2011 Initial characterization of the human central proteome.
20616062 2010 Human ESCRT-III and VPS4 proteins are required for centrosome and spindle maintenance.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
19640981 2009 Human cytomegalovirus exploits ESCRT machinery in the process of virion maturation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19302785 2009 Ab initio protein modelling reveals novel human MIT domains.
19129480 2009 Essential role of hIST1 in cytokinesis.
19129479 2009 Biochemical analyses of human IST1 and its function in cytokinesis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18787405 2008 Chmp1A functions as a novel tumor suppressor gene in human embryonic kidney and ductal pancreatic tumor cells.
17928862 2007 ESCRT-III recognition by VPS4 ATPases.
17711858 2007 The MIT domain of UBPY constitutes a CHMP binding and endosomal localization signal required for efficient epidermal growth factor receptor degradation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14519844 2003 Divergent retroviral late-budding domains recruit vacuolar protein sorting factors by using alternative adaptor proteins.
14505570 2003 The protein network of HIV budding.
14505569 2003 AIP1/ALIX is a binding partner for HIV-1 p6 and EIAV p9 functioning in virus budding.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445808 2002 Physical interaction between hepatitis C virus NS4B protein and CREB-RP/ATF6beta.
11559748 2001 CHMP1 functions as a member of a newly defined family of vesicle trafficking proteins.
11559747 2001 CHMP1 is a novel nuclear matrix protein affecting chromatin structure and cell-cycle progression.
9837962 1998 Identification of the cis-acting endoplasmic reticulum stress response element responsible for transcriptional induction of mammalian glucose-regulated proteins. Involvement of basic leucine zipper transcription factors.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8863740 1996 Molecular cloning, expression and chromosomal localization of a human gene encoding a 33 kDa putative metallopeptidase (PRSM1).
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.