Property Summary

NCBI Gene PubMed Count 11
PubMed Score 125.01
PubTator Score 17.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.499 2.9e-05
glioblastoma 1.600 2.8e-02
juvenile dermatomyositis 1.161 1.8e-10
tuberculosis -1.400 1.8e-07
lung cancer -1.200 9.8e-04
group 3 medulloblastoma 1.200 2.9e-02
posterior fossa group B ependymoma 1.100 3.1e-04
aldosterone-producing adenoma -1.284 1.3e-02
spina bifida -1.703 3.6e-02

Pathway (1)

Gene RIF (2)

PMID Text
19118897 studied a new FISH method to detect CHIC2 deletion, FIP1L1/PDGFRA fusion and PDGFRA translocation in patients with myeloid neoplasms associated with eosinophilia
12842979 used fluorescence in situ hybridization to detect deletion of the CHIC2 locus at 4q12 as a surrogate for the FIP1L1-PDGFRA fusion and was observed in bone marrow cells for 3 of 5 patients with systemic mast cell disease associated with eosinophilia

AA Sequence

MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINR      1 - 70
VNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRK     71 - 140
CETNNMMEYVILIEFLPKTPIFRPD                                                 141 - 165
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
19118897 2009 Validation of a new three-color fluorescence in situ hybridization (FISH) method to detect CHIC2 deletion, FIP1L1/PDGFRA fusion and PDGFRA translocations.
19060904 2009 An empirical framework for binary interactome mapping.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12842979 2003 CHIC2 deletion, a surrogate for FIP1L1-PDGFRA fusion, occurs in systemic mastocytosis associated with eosinophilia and predicts response to imatinib mesylate therapy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11257495 2001 A new family of small, palmitoylated, membrane-associated proteins, characterized by the presence of a cysteine-rich hydrophobic motif.
10477709 1999 Fusion of a novel gene, BTL, to ETV6 in acute myeloid leukemias with a t(4;12)(q11-q12;p13).