Property Summary

NCBI Gene PubMed Count 452
PubMed Score 933.47
PubTator Score 885.31

Knowledge Summary

Patent (45,013)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Breast cancer 3098 0.0 1.0
Carcinoma 2147 0.0 1.0
DOID:2627 14 0.0 1.0
Disease Target Count Z-score Confidence
Gastrointestinal system cancer 3 0.0 2.0
Glaucoma 135 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 5.821 2.9
Li-Fraumeni syndrome 13 5.055 2.5
Disease Target Count Z-score Confidence
Ataxia telangiectasia 32 4.828 2.4
Nijmegen breakage syndrome 23 4.414 2.2

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.124 2.2e-03
malignant mesothelioma 1.200 1.5e-05
glioblastoma 1.300 6.3e-07
sonic hedgehog group medulloblastoma 1.800 7.7e-06
atypical teratoid / rhabdoid tumor 1.400 8.1e-07
medulloblastoma, large-cell 2.100 2.1e-06
primitive neuroectodermal tumor 1.100 1.3e-03
tuberculosis 1.400 4.7e-06
non-small cell lung cancer 1.441 1.6e-16
lung cancer 2.000 3.3e-04
pediatric high grade glioma 1.100 1.4e-05

Protein-protein Interaction (2)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (468)

PMID Text
26991782 CHEK2 mutation carriers were characterized by older age, a history of gastric cancer in the family, locally advanced disease, lower histologic grade and luminal B type breast cancer.
26831064 loss of CHK2 or PP6C-SAPS3 promotes Aurora-A activity associated with BRCA1 in mitosis
26577449 The aim of this study was to determine the frequency and spectrum of germline mutations in BRCA1, BRCA2 and PALB2 and to evaluate the presence of the CHEK2 c.1100delC allele in these patients.
26573794 Authors propose that CHK2 is a negative regulator of androgen sensitivity and prostate cancer growth, and that CHK2 signaling is lost during prostate cancer progression to castration resistance.
26553136 we observed a great degree of heterogeneity amongst the CHEK2*1100delC breast cancers, comparable to the BRCAX breast cancers. copy number aberrations were mostly seen at low frequencies in both the CHEK2*1100delC and BRCAX group of breast cancers.
26506619 germ-line CHEK2 mutations affecting protein coding sequence confer a moderately-increased risk of NHL, they are associated with an unfavorable NHL prognosis, and they may represent a valuable predictive biomarker for patients with DLBCL.
26483394 CHEK2 mutation is associated with Pancreatic Cancer.
26447757 Data suggest that nitroxoline induces anticancer activity through AMP-activated kinase (AMPK)/mTOR serine-threonine kinase (mTOR) signaling pathway via checkpoint kinase 2 (Chk2) activation.
26424751 Variants at the CHEK2 locus are associated with risk of invasive epithelial ovarian cancer. [meta-analysis]
26084796 The germline mutations of the CHEK2 gene are associated with an increased risk of polycythaemia vera.
26083025 Mutations in CHEK2 were most frequent in patients with hereditary non-triple-negative breast cancers.
26061604 Via activation of the ATM/ATR-Chk1/Chk2 check point pathway.
26054341 These data provide a rationale for further evaluation of the combination of Wee1 and Chk1/2 inhibitors in malignant melanoma.
26025911 Role of Chk2 protein in the DNA damage response through the base excision repair pathway
25962492 Phosphorylation of ATR and CHK1 did not show significant differences in the three cell groups. Overexpression of SHP-1 in the CNE-2 cells led to radioresistance and the radioresistance was related to enhanced DNA DSB repair.
25958056 CHEK2 and non-CHEK2 patients had a comparable objective response rate.
25884806 CHEK2 H371Y mutation carriers are more likely to respond to neoadjuvant chemotherapy than are non-carriers
25872745 HBx-induced reactive oxygen species accumulation induces DNA damage that activates the ATM-Chk2 pathway.
25850293 The Russian carriers of BRCA1, BRCA2 and CHEK2 germline mutations have genetic predisposition to breast, ovarian, and colorectal cancer.
25842825 Frequency of CHEK2 gene mutations in patients with breast cancer from the Republic of Bashkortostan
25835597 The study indicates that the CHEK2 c.1100delC mutation does not contribute substantially to hereditary breast cancer in patients of Greek descent.
25773391 our results further revealed that expression of tumor suppressor gene, checkpoint kinase 2, was negatively regulated by miR-191
25629968 The results of this study suggest that CHEK2 mutations are rare among high-risk breast cancer patients and may play a minor contributing role in breast carcinogenesis among Malaysian population.
25619829 our results not only identified a novel CHEK2 allele that is associated with cancer families and confers increased breast cancer risk, but also showed that this allele significantly impairs CHEK2 function during DNA damage response
25583358 These results suggest that CHEK2 mutations predispose to thyroid cancer, familial aggregations of breast and thyroid cancer and to double primary cancers of the breast and thyroid.
25531207 This report demonstrates the critical role of Chk2 kinase in the establishment of HSV-1 corneal epithelial infection.
25483076 Chk2 inactivation in B cells leads to decreased immunoglobulin hypermutation and increased conversion activity.
25449779 High CHEK2 expression is associated with trastuzumab-resistant breast cancer.
25425972 Data suggest that ataxia telangiectasia mutated protein (ATM)-checkpoint kinase 2 (Chk2) levels in sporadic breast cancer may have prognostic and predictive significance.
25414026 This study provides evidence for distinct sensitivity of BRCA1 and CHEK2 mutation-driven breast carcinomas to standard chemotherapeutic schemes.
25404613 CHK2 participates in several molecular processes involved in DNA structure modification and cell cycle progression
25361978 The results link Chk2 and REGgamma to the mechanism underlying the DBC1-dependent SIRT1 inhibition.
25355026 Inherited mutations in the CHEK2 gene have been identified in some cases of breast cancer
24998580 CHEK2 gene mutations are not associated with differentiated thyroid carcinoma.
24986639 REsults indicate that CHEK2 rare variants, such as duplications, can confer a high susceptibility to cancer development.
24976383 Chromosomal instability is induced by overexpression of the oncogene AURKA or by loss of the tumour suppressor gene CHK2, a genetic constitution found in colorectal cancers.
24918820 No significant interaction between CHEK2 and adjuvant chemotherapy was observed.
24880342 CHEK2 p.Ile157Thr is associated with lung cancer.
24879340 CHEK2 mutations were observed with high intensity and associated with poor therapy response and overall survival in high grade serous ovarian cancer.
24853623 selective targeting of Chk1 and Chk2 by oncolytic adenovirus mutants was chosen to treat resistant tumor xenograft mice, and the maximum antitumoral efficacy was achieved with the combined co-abrogation of Chk1 and Chk2
24798733 Chk2 stabilizes Mps1 and phosphorylates Aurora B-serine 331 to prevent mitotic exit when most kinetochores are unattached.
24764296 Our results provide evidence of a newly identified hMps1 phosphorylation site that is involved in the mitotic checkpoint and that CHK2 contributes to chromosomal stability through hMps1.
24662822 DNA-PK/Chk2 signaling induces centrosome amplification upon long-term HU treatment, therefore increasing our insight into tumor recurrence after initial chemotherapy.
24657486 Chk2-depleted ovarian cancer cell lines have diminished platinum sensitivity.
24599715 The findings implicate an important role of variants in the ATM- CHEK2- BRCA1 axis in modification of the genetic predisposition to papillary thyroid carcinoma and its clinical manifestations.
24557336 The adjusted hazard ratio associated with a CHEK2 mutation was 1.31.
24532427 The gene polymorphisms in CHEK2, GSTP1, and ERCC1 may be involved in glioblastoma in the Han Chinese population.
24498068 As evidenced by release through Chk2 inhibition.
24480460 data provide strong evidences that Aurora-A and BRCA1/2 inversely control the sensitivity of cancer cells to radio- and chemotherapy through the ATM/Chk2-mediated DNA repair networks
24415413 Development of breast tumors in CHEK2, NBN/NBS1 and BLM mutation carriers does not commonly involve somatic inactivation of the wild-type allele.
24390236 To our knowledge, this is first mutation scanning study of gene CHEK2 from Balochistan population.
24065469 CHEK2 Del5395bp mutation is associated with breast cancer susceptibility.
24021642 the DNA-PKcs/CHK2 pathway mediates the mitotic phosphorylation of H2AX in the absence of DNA damage.
24002546 These findings indicate that DHM inhibits the growth of hepatocellular carcinoma (HCC) cells via G2/M phase cell cycle arrest through Chk1/Chk2/Cdc25C pathway.
23969480 we elucidated the prognostic implications of the expressions of ATM, Chk2, and p53, in gastric carcinoma
23821772 Studies indicate that autophosphorylation of Nek7 and Plk4 occurred through an intermolecular mechanism, the kinases Aurora-A and Chk2 followed an intramolecular mechanism.
23806170 Our findings suggest that CHEK2 mutations may not contribute significantly to breast/ovarian cancer risk in Pakistani women.
23803109 CHEK2-1100delC and BRCA2- Met784Val mutation haplotype is associated with breast cancer.
23713947 CHEK2 I157T variant increases cancer risk, especially in breast and colorectal cancer in Caucasian population.
23690919 Chk2 interacts with SMRT and regulates different transcription factors, acting as a repressor.
23449389 Findings indicate that PIRH2 has central roles in the ubiquitylation of Chk2 and its turnover and in the regulation of its function.
23415889 Data indicate that genotyping for the CHEK2 1100delC mutation in a familial breast cancer setting contributes to optimal clinical surveillance in countries in which this mutation is prevalent.
23333640 HIF-2alpha is involved in the blocking effects of arsenite on activation of the ATM/Chk-2 pathway and in repair of DNA damage induced by BaP in HBE cells.
23329222 The 1100delC mutation was encountered in the germline of one (1.7%) individual in this high risk cohort which indicates that the CHEK2 1100delC is not commonly encountered in Brazilian families with multiple diagnoses of breast and colorectal cancer.
23296741 CHEK2 mutations are associated with gastric cancer.
23269272 MYC regulation of CHK1 and CHK2 promotes radioresistance in a stem cell-like population of nasopharyngeal carcinoma cells.
23178491 CHK2 kinase constitutively phosphorylates CDK11(p110) in a DNA damage-independent manner.
23150219 In our study, we demonstrate the presence of c.1100delC mutation in Galician (Northwest Spain) hereditary breast cancer families
23109706 Among women with estrogen receptor-positive breast cancer, CHEK2*1100delC heterozygosity was associated with a 1.4-fold risk of early death, a 1.6-fold risk of breast cancer-specific death, and a 3.5-fold risk of a second breast cancer.
23107771 CHK2 1100delC, IVS2+1G>A and I157T mutations are not present in hepatocellular cancer cases from a Turkish population.
23073808 There was no conspicuous activation of Chk2 kinase in 0.1 or 0.2 Gy group.
22994785 A significant association was found between CHEK2 1100delC heterozygote and breast cancer risk.
22946335 Higher frequencies of these mutations in the patient group compared to the control sample (1.95 versus 0.25% for BRCA1 5382insC, and 1.78 versus 0.40% for CHEK2 1100delC) were observed, pointing to their association with susceptibility to breast cancer
22901170 The CHEK2 I157T variant is associated with colorectal cancer susceptibility.
22862163 data indicate the significance of CHEK2 gene alterations in contrast to promoter hypermethylation in breast cancerogenesis
22811390 Five percent of women with uterine serous carcinoma have germline mutations the tumor suppressor genes BRCA1, CHEK2, and TP53.
22808196 Knockdown of the human DNA helicase RRM3 enhances phosphorylation of the cell cycle arrest kinase Chk2, indicating activation of the checkpoint via the ATM/Chk2 pathway.
22799331 Our research indicates that the CHEK2 I157T variant may be another important genetic mutation which increases risk of breast cancer, especially the lobular type.
22770119 The results show increased phosphorylation of H2AX, ATM, and Chk2 after exposure, and that nano-TiO2 inhibited the overall rate of DNA synthesis and frequency of replicon initiation events.
22658458 Higher phosphorylation levels of CHK2 is associated with poor treatment response in rectal cancer.
22586065 findings suggest that Chk2-mediated phosphorylation of survivin-DeltaEx3 contributes to a DNA damage-sensing checkpoint that may affect cancer cell sensitivity to genotoxic therapies
22521562 CHEK2 1100delC, IVS2+1G>A and I157T mutations have not been agenetic susceptibility factor for Colorectal cancer in the Turkish population.
22420423 loss of function of the ATM-Chek2-p53 cascade is strongly associated with resistance to anthracycline/mitomycin-containing chemotherapy in breast cancer
22419737 Data suggest that in vivo assay of cellular response to DNA damage by mutant CHEK2 alleles may complement and extend epidemiologic and genetic assessment of their clinical consequences.
22355270 alternative splicing and frequent codeletion of CHEK2 and NF2 contribute to the genomic instability and associated development of aggressive biologic behavior in meningiomas.
22294770 CHEK2 gene polymorphisms are assciated with colorectal cancer.
22211259 structural insight into MDC1-CHK2 interaction
22201027 The CT allele of single nucleotide polymorphisms (SNP) rs738722 and the GC allele of SNP rs2236142 might be a protective factor of the risk for lymph node metastasis of esophageal cancer.
22160829 Widdrol breaks DNA directly in HT29 cells, resulting in checkpoint activation via Chk2-p53-Cdc25A-p21-MCM4 pathway and finally cells go to G1-phase cell cycle arrest and apoptosis.
22159226 Chk2-induced phosphorylation enables TR3 to bind to its response elements on the promoters of the BRE and RNF-7 genes.
22158418 The Chk2 protein is as an essential mediator of the cellular responses to RITA.
22114986 a variety of deleterious CHEK2 alleles make an appreciable contribution to breast cancer susceptibility, and their identification could help in the clinical management of patients carrying a CHEK2 mutation.
22072393 report of four interactions between mutations in the breast cancer susceptibility genes ATM and CHEK2 with BRCA1 and BRCA2
22071692 Checkpoint kinase-2 (Chk2) binds to the beta-domain of pVHL and phosphorylates Ser 111 on DNA damage.
22058428 Mutations in CHEK2 gene confer a moderately increased risk of breast cancer in women from non-BRCA1/2 families.
22058216 CHEK2 mutations could potentially contribute to the susceptibility to essential thrombocythemia. The germline inactivation of CHEK2, as it seems, has no direct impact on the development of disease.
21956126 CHEK2*1100delC heterozygotes have a twofold risk of malignant melanoma compared with noncarriers.
21945852 Data suggest that combination treatment with radiation and uPAR knock down or Chk2 inhibitor resulting in non-reversible G2/M arrest may be beneficial in the management of meningiomas.
21934670 Vpr-dependent induction and Vif-mediated attenuation of NKG2D ligands are required for Chk2 phosphorylation in HIV infection
21924579 findings demonstrated that ethanol metabolism activates ataxia telangiectasia mutated (ATM) which can activate checkpoint kinase 2 (Chk2)
21907711 X-ray structures of checkpoint kinase 2 in complex with inhibitors that target its gatekeeper-dependent hydrophobic pocket.
21876083 CHEK2 mutation screening detects a clinically meaningful risk of breast cancer and should be considered in all women with a family history of breast cancer.
21874023 Vpr-dependent induction and Vif-mediated attenuation of NKG2D ligands are required for Chk2 phosphorylation in HIV infection
21807500 This meta-analysis demonstrates that the CHEK2 1100delC variant may be an important colorectal cancer-predisposing gene, which increases colorectal cancer risk.
21787115 CHEK2 polymorphisms are associated with endometrial cancer.
21772273 Functional and molecular interactions between ERK and CHK2 in diffuse large B-cell lymphoma.
21765476 high heterogeneity of Chk2 levels in cancer cells is primarily due to its inactivation (owing to low gene expression, alternative splicing, point mutations, copy-number alterations and premature truncation) or reduction of protein levels.
21744992 Mutations in CHEK2 gene is associated with Hodgkin lymphoma.
21701879 CHEK2-I157T variant was associated with the luminal A subtype, whereas CHEK2-truncating mutations were associated with the luminal B subtype.
21618645 The recurrent mutation, p.H371Y of CHEK2, confers a moderate risk of breast cancer in Chinese women.
21614566 The identification of a CHEK2 gene signature implies an unexpected biological homogeneity among the CHEK2 1100delC breast cancers. All CHEK2 1100delC tumors classified as luminal intrinsic subtype breast cancers.
21562711 CHEK2 gene may act as a factor contributing to individual tumor development in peculiar familial backgrounds.
21356067 The CHEK2 gene was screened for mutations in well-characterized, Finnish, high-risk hereditary breast and/or ovarian cancer individuals.
21317874 The authors propose that the release of HuR-bound mRNAs via an ionizing radiation-Chk2-HuR regulatory axis improves cell outcome following ionizing radiation.
21244692 CHEK2 harbors many rare sequence variants that confer increased risk of breast cancer.
21184685 The germ line CHK2 1100delC variant does not seem to have a major impact on the development of squamous cell carcinoma of the head and neck.
21156285 Loss of ATM/Chk2/p53 pathway components accelerates tumor development and contributes to radiation resistance in gliomas.
21118956 In response to ultraviolet radiation, Lats2 is phosphorylated by Chk1 and Chk2 at S408.
21070773 Per3 is a checkpoint protein that plays important roles in checkpoint activation, cell proliferation and apoptosis.
21034966 ATM-Chk2 and ATR-Chk1 pathways have roles in DNA damage signaling and cancer [review]
20875877 These data are consistent with the reported very low frequency of CHEK2*1100delC mutations in North American populations.
20875877 Observational study of gene-disease association. (HuGE Navigator)
20731661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20722467 CHEK2, STK11, and PALB2 mutations or large genomic rearrangements of either STK11 or PALB2 are rare, and do not contribute to a substantial fraction of breast cancer susceptibility in high-risk French Canadian breast cancer families.
20722467 Observational study of gene-disease association. (HuGE Navigator)
20713355 complex interdependent network of phosphorylation events within the T-loop exchange region regulates dimerization/autophosphorylation, kinase activation, and chromatin targeting/egress of Chk2.
20668524 Study show that siRNA-silencing of the ATM downstream effector, the protein kinase checkpoint kinase 2 (Chk2), significantly impacted CDT-mediated apoptosis of gingival epithelial cells.
20658728 CHEK2 single nucleotide polymorphism is not relevant for colorectal cancer risk in Bulgaria.
20658728 Observational study of gene-disease association. (HuGE Navigator)
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20643596 The I157T, other alterations in its proximity, del5395 and c.1100delC in CHEK2 do not predispose to pancreatic cancer risk in the Czech population.
20599567 Data indicate a novel mechanism in undamaged cells where PPs function to maintain the balance between ATM and its direct substrate Chk2 through a regulatory circuit.
20581449 Chk2 centrosomal binding does not require DNA damage, but varies according to cell cycle progression.
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20472656 This study assessed the pathological mutation detection rates for BRCA1, BRCA2 and the CHEK2c.1100 delC mutation in 2022 women with breast cancer, including 100 with breast/ovary double primary and 255 with bilateral breast cancer.
20472656 Observational study of gene-disease association. (HuGE Navigator)
20462940 CHEK2 rs2236141 variant modifies lung cancer susceptibility in the Chinese population by affecting CHEK2 expression.
20462940 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20442702 liink between mitosis and dna damage
20434834 Ron overexpression on a Chk2*1100 deletion background accelerates the development of mammary tumors.
20417869 Observational study of genetic testing. (HuGE Navigator)
20364141 report a function of Chk2, independent of p53 and DNA damage, that is required for proper progression of mitosis, and for the maintenance of chromosomal stability in human somatic cells
20306497 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20204303 The water extract of the lettuce Lactuca sativa activated checkpoint kinase 2, induced the tumour suppressor p21, and downregulated the proto-oncogene cyclin D1 in HL-60 leukaemia cells and MCF-7 breast cancer cells
20200249 The authors suggest that the Chk2 phosphorylation of TRF2 is important for coordinating origin recognition complex binding to OriP of Epstein-Barr virus and that a failure to execute these events leads to virus replication defects.
20159774 The DNA damage-activated kinases Chk1 and Chk2 may be involved in tau phosphorylation and toxicity in the pathogenesis of Alzheimer's disease.
20080130 Data suggest alternative splicing as a possible novel mechanism for repression of the Chk2 wild-type function.
20023427 The checkpoint kinase 2 appears to have a conserved function in control of mitotic progression following G(2)/M transition with DNA damage.
20023412 Increased CHK2 expression is associated with colorectal tumor progression.
19996108 TIMELESS is required for ATM-dependent CHK2 activation and G2/M checkpoint control
19922265 Data show that coralyne treatment photosensitizes DNA, leading to p53- and Chk2-dependent apoptosis in tumor cell lines.
19881958 ATM relays the DNA DSBs signaling triggered by the naphthalimides to the checkpoint kinases, predominantly to Chk2
19876921 The I157T variant of CHEK2 is associated with colorectal cancer.
19876921 Observational study of gene-disease association. (HuGE Navigator)
19863560 a predisposing mutation in CHEk2,is present in approximately 6% of French-Canadian women with early-onset breast cancer
19863560 Observational study of gene-disease association. (HuGE Navigator)
19855918 CHEK2 variant, rs4035540, was associated with an increased risk of type 2 diabetes.
19840931 Mitochondrial DNA damage initiates a cell cycle arrest by a Chk2-associated mechanism in mammalian cells.
19839522 Patients with CHEK2 mutation may present poorer clinical course with several recurrences of Superficial Bladder Cancer. It also suggests a possible prognostic significance of CHEK2 analysis
19798429 caspase cleavage is induced upon differentiation of HPV positive cells through the action of the DNA damage protein kinase CHK2, which may be activated as a result of E7 binding to the ATM kinase.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19782031 Report structure and activation mechanism of the CHK2 DNA damage checkpoint kinase.
19772467 Chk2 functions to maintain genome integrity after radiation-induced damage
19768534 our study reveals the presence of CHEK2 exon 10 truncated mutations in two of 392 high-risk breast/ovarian cancer family probands
19763819 CHEK2_1100delC and BRIP1 mutations incidence in Ireland is similar to that found in other unselected breast cancer cohorts from northern European countries.
19763819 Observational study of gene-disease association. (HuGE Navigator)
19714462 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19656415 Observational study of gene-disease association. (HuGE Navigator)
19615254 Down-regulating Chk1 and Chk2 may increase the apoptotic sensitivity to irradiation due to changes of the pattern of cell cycle specific apoptosis.
19609724 CHEK2*I157T missense mutation is a founder mutation in ethnically diverse populations, but may also be a mutational hotspot.
19597488 Data show that initiation and maintenance of the IL-6 secretion required the DDR proteins ATM, NBS1 and CHK2.
19548527 Observational study of gene-disease association. (HuGE Navigator)
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19480937 Recurrent loss, but lack of mutations, of the SMARCB1 tumor suppressor gene in T-cell prolymphocytic leukemia with TCL1A-TCRAD juxtaposition.
19473886 The structure, regulation, and functions of Chk1 and Chk2 in the DNA damage response, as well as their potential roles in human disease, is discussed.
19453842 Suppression of the Chk1/Chk2 protein by shRNA constructs inhibited the growth of oral pulp cells, which indicates that these checkpoint proteins may be essential for normal cell growth.
19451272 RAD51C is required for activation of the checkpoint kinase CHK2 and cell cycle arrest in response to DNA damage.
19401704 Risk of cancer in a carrier of a CHEK2 mutation is dependent on the family history of cancer.
19401704 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19399639 *1100delC is unlikely to contribute significantly to risk to breast cancer among the Malay, Chinese and Indian ethnic groups in Malaysia
19399639 Observational study of gene-disease association. (HuGE Navigator)
19375317 Data suggest that TRF2 repression of Chk2 provides an additional level of control by which shelterin prevents unwanted DNA damage responses, and may explain why TRF2 overexpression acts as a telomerase-independent oncogenic stimulus.
19372713 It was shown that the presence of the mutations in the BRCA1/2 genes among patients with bilateral breast cancer is associated with an earlier occurrence of the first and the second breast cancer than in patients without hereditary mutations.
19372713 Observational study of gene-disease association. (HuGE Navigator)
19362748 down-regulation of CHK2 gene via distal promoter CpG islands methylation may play a role in the pathogenesis of non-small cell lung cancers
19338683 Observational study of gene-disease association. (HuGE Navigator)
19338682 Observational study of gene-disease association. (HuGE Navigator)
19289404 Cdc25A degradation depended on Ser75-Cdc25A phosphorylation caused by p38MAPK and Chk2.
19275588 Vpr-dependent induction and Vif-mediated attenuation of NKG2D ligands are required for Chk2 phosphorylation in HIV infection
19265784 a polymorphism of the CHEK2 gene is associated with measures of kidney function. These results suggest that CHEK2, a protein involved in cell cycle regulatory pathways, may influence kidney function in the context of hypertension.
19265784 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19177012 Results indicate that Chk2 (but not Chk1) participates in the DNA damage-elicited pro-apoptotic cascade that leads to the demise of Env-elicited syncytia.
19177012 Vpr-dependent induction and Vif-mediated attenuation of NKG2D ligands are required for Chk2 phosphorylation in HIV infection
19176998 Results suggest that Mdm2 and PCAF may function as part of a multi-subunit E3 complex in their regulation of Chk2 turnover.
19164952 Vpr-dependent induction and Vif-mediated attenuation of NKG2D ligands are required for Chk2 phosphorylation in HIV infection
19151762 a regulatory loop between TTK/hMps1 and CHK2 whereby DNA damage-activated CHK2 may facilitate the stabilization of TTK/hMps1, therefore maintaining the checkpoint control.
19124506 Observational study of gene-disease association. (HuGE Navigator)
19124502 Life time risks for CHEK2 1100delC carrier and noncarrier daughters of bilateral breast cancer cases of 37% and 18%, respectively.
19124502 Meta-analysis of gene-disease association. (HuGE Navigator)
19116388 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19062161 MT-2A could plausibly modulate cell cycle progression from G1- to S-phase via the ATM/Chk2/cdc25A pathway.
19030985 the BRCA2 T1915M polymorphism alone might be associated with a reduced risk of breast cancer, but among CHEK2 mutation carriers, it may lead to an unexpectedly high risk.
19030985 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19021634 Women with a CHEK2 mutation face a fourfold increase in the risk of estrogen receptor-positive breast cancer
19021634 Observational study of gene-disease association. (HuGE Navigator)
19020308 Zalypsis provoked DNA double-strand breaks (DSBs), evidenced by an increase in phospho-histone-H2AX and phospho-CHK2, followed by a striking overexpression of p53 in p53 wild-type cell lines
18996005 The CHEK2 gene I157T mutation and other alterations in its proximity increase the risk of sporadic colorectal cancer in the Czech population.
18996005 Observational study of gene-disease association. (HuGE Navigator)
18971944 Chk2 formed a complex with XRCC1, the BER scaffold protein, and phosphorylated XRCC1 in vivo and in vitro at Thr(284).
18957425 Tax binds to and stabilizes a protein complex with DNA-PK and Chk2, resulting in a saturation of DNA-PK-mediated damage repair response
18955500 These findings suggest that nuclear activation of Chk2 by TRAIL acts as a positive feedback loop involving the mitochondrion-dependent activation of caspases, independently of p53.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18948271 autophosphorylation of the FHA domain at the highly conserved Ser-140 position, a major pThr contact in all FHA-phosphopeptide complex structures, revealing a mechanism of Chk2 dimer dissociation following kinase domain activation.
18930998 Our study suggests that the risk of breast cancer in carriers of a deleterious CHEK2 mutation is increased if the second allele is the I157T missense variant. the presence of a CHEK2 mutation in women with a BRCA1 mutation may not increase their risk
18930998 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18834326 The I157T single nucleotide polymorphism is overrepresented in endometrial cancer patients diagnosed at 75 or more years of age (9.09%, p = 0.05) and in those with deep myometrial invasion (3.85%, p = 0.06).
18834326 Observational study of gene-disease association. (HuGE Navigator)
18833288 Strap regulation reflects the coordinated interplay between different DNA damage-activated protein kinases, ATM and Chk2 (Checkpoint kinase 2), where phosphorylation by each kinase provides a distinct functional consequence on the activity of Strap.
18812180 The intramolecular phosphorylation sites in CHK2 are explored.
18802408 maximum expression of p53-Ser15(P) coincided in time with the peak of Chk2 activation
18797466 a link between CHEK2 and BRCA2 pathways
18759107 in the Netherlands, CHEK2 1100delC is associated with an increased risk for male breast cancer
18759107 Observational study of gene-disease association. (HuGE Navigator)
18725978 Germline CHEK2 mutations are associated resistance to drug therapy in breast cancer paatients.
18725978 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18706089 analysis of a novel CHEK2 missense variant, R406H, that is found to be unlikely to contribute to breast cancer risk in French Canadian women
18706089 Observational study of gene-disease association. (HuGE Navigator)
18676774 the 1100delC variant of CHEK2 confers a colorectal cancer risk in HNPCC/HNPCC-related families
18676774 Observational study of gene-disease association. (HuGE Navigator)
18667510 the ATM-Chk2 signaling pathway is critical for HCV RNA replication
18644861 Auto-/transphosphorylation of Serine 379 is required for Chk2 ubiquitination and effector function.
18571837 germline CHEK2 mutations have a minor role in, if any, prostatic cancer susceptibility in Ashkenazi Jewish men.
18571837 Observational study of gene-disease association. (HuGE Navigator)
18566483 A quantitative cell-based assay using a high-content analysis platform was developed in an effort to identify small-molecule activators of CHK2.
18566216 These findings systematically dissect the differential roles of Chk1 and Chk2 in a favorable model pursuing camptothecin-driven DNA damage responses.
18557994 analysis of how the breast cancer genes ATM, BRIP1, PALB2 and CHEK2 affect risk for women with strong family histories [review]
18538787 Autophosphorylated residues involved in the regulation of CHEK2 in vitro are described.
18484200 CHEK2.1100delC mutation may be a rare variant in Chinese, may be an association between genetic susceptibility to breast cancer in China and the variant 1111C>T.
18484200 Observational study of gene-disease association. (HuGE Navigator)
18482988 ATO-induced activation of Chk2/p53 and p38 MAPK/p53 apoptotic pathways can be enhanced by siRNA-mediated suppression of Wip1 expression, further indicating that ATO inhibits Wip1 phosphatase in vivo
18415014 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18381943 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18381420 The frequency of the CHEK2 founder allele was measured in 3,882 breast cancer patients and 8,609 controls from various countries.
18381420 Observational study of gene-disease association. (HuGE Navigator)
18321553 Chk2 deficiency diminished the growth of wild-type HSV-1, but not the growth of an ICP0-deleted recombinant virus.
18317453 Chk1 and Chk2 regulate the functional associations between hBRCA2 and Rad51 in response to DNA damage
18297428 Mutations L303X & 1100delC cause a premature termination codon preventing CHEK2 & P-Thr68 CHEK2 protein expression. CHEK2 & p53 operate in the same tumor suppressor pathway.A main CHEK2 oncogenic function involves p53-mediated G1 cell-cycle arrest.
18281249 Lung cancer cells from people with impaired CHEK2 function undergo increased rates of cell death.
18281249 Observational study of gene-disease association. (HuGE Navigator)
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18253122 No significant associations was found between the CHEK2*1100delC mutation and contralateral breast cancer
18253122 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18178638 We believe that CHEK2 mutations are not associated with the cancer types seen in the LFS or LFL (other than breast cancer) and it is no longer reasonable to consider CHEK2 mutations to be a cause of LFS (Li-Fraumeni syndrome).
18175216 The CHEK2 1100delC mutation is not present in Korean patients with breast cancer cases tested for BRCA1 and BRCA2 mutation
18175216 Observational study of genotype prevalence. (HuGE Navigator)
18172190 Meta-analysis of gene-disease association. (HuGE Navigator)
18172190 Since risk of breast cancer at age 70 years among familial patient cases for CHEK2*1100delC heterozygotes is almost as high as for BRCA1 and BRCA2 mutation heterozygotes, genotyping should be considered in women with a family history of breast cancer.
18167186 The CHK2 mutation in colorectal cancer is a low frequency event.
18162465 an important role for the DNA damage response mediated by ATR-Chk2 in p53 activation and renal cell apoptosis during cisplatin nephrotoxicity.
18086786 pChk2 merits further investigation as a promising biomarker that can discriminate those lesions at risk for developing SCC, regardless of histologic evidence for atypia.
18086781 Observational study of gene-disease association. (HuGE Navigator)
18085035 CHEK2 missense mutations may contribute to breast cancer susceptibility in Ashkenazi Jews.
18058223 Novel missense variants of CHEK2 is associated with breast cancer.
18058223 Observational study of gene-disease association. (HuGE Navigator)
18024013 Observational study of gene-disease association. (HuGE Navigator)
18004398 Parallel studies of the human CHEK2 gene have also highlighted its role as a candidate multiorgan tumour susceptibility gene rather than a highly penetrant predisposition gene for Li-Fraumeni syndrome.
17918154 Observational study of gene-disease association. (HuGE Navigator)
17918154 Germline mutations in the CHEK2 kinase gene are associated with bladder cancer
17876702 The findings suggest that the CHEK2 100delC mutation is not present or is present at an extremely low frequency in Chilean families with familial breast cancer.
17721994 Observational study of gene-disease association. (HuGE Navigator)
17721994 clinical testing for rare missense mutations within CHEK2 may have limited value in predicting breast cancer risk, but that testing for the 1100delC variant may be valuable in phenotypically- and geographically-selected populations.
17715138 checkpoint kinase 2 stability is regulated via phosphorylation at serine 456
17705858 Observational study of gene-disease association. (HuGE Navigator)
17705858 In total 2.2% of the patients with a family history of breast cancer carried the variant compared to 0.7% of the controls.
17698850 Tax binding via the Chk2 kinase domain sequesters phosphorylated Chk2 within chromatin, thus hindering chromatin egress and appropriate response to DNA damage
17694537 CHK2 truncated protein could not be detected, even when nonsense-mediated mRNA decay (NMD) mechanism was inhibited. This suggests that CHK2 truncated protein is unstable
17684142 Observational study of gene-disease association. (HuGE Navigator)
17671118 Chk2 inactivation is associated with intraductal papillary mucinous neoplasms of the pancreas
17663721 The results indicate a critical role for Chk2 in methylglyoxal-induced G(2)/M cell-cycle checkpoint arrest.
17661168 BRCA1/2 rearrangements is not advantageous in male breast neoplasm (MBC) cases not belonging to high-risk breast cancer families and that common CHEK2 mutations play an irrelevant role in MBC predisposition in Italy.
17661168 Observational study of gene-disease association. (HuGE Navigator)
17634426 This is the first report of high ATM-Chk2 kinase activation and its linkage to replication defects in a Bloom syndrome model.
17544403 Phosphorylation of p53 (Ser15), Chk1 (Ser345), and Chk2 (Thr68) was also observed, suggesting that H/R activates p53 through checkpoint signals.
17517688 Observational study of gene-disease association. (HuGE Navigator)
17517688 CHEK2 mis-sense variant and reduced risk of tobacco-related cancers
17464182 Novel substrates for Chk1 and Chk2 were screened using substrate target motifs determined previously by an oriented peptide library approach.
17428325 Observational study of gene-disease association. (HuGE Navigator)
17428325 common polymorphisms in the ATM, BRCA1, BRCA2, CHEK2 and TP53 cancer susceptibility genes are not shown to increase breast cancer risk
17428320 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17409195 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17409144 EBNA3C can directly regulate the G2/M component of the host cell cycle machinery through ATM/ATR and Chk2, allowing for the release of the checkpoint block
17380889 Observational study of genotype prevalence. (HuGE Navigator)
17372254 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17341484 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17333477 Observational study of genotype prevalence. (HuGE Navigator)
17333333 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17317627 HuR regulates SIRT1 expression, underscore functional links between the two stress-response proteins, and implicate Chk2 in these processes.
17250914 Observational study of gene-disease association. (HuGE Navigator)
17250914 Heterozygosity for a germline CHEK2 mutation appears to represent an adverse prognostic factor in patients with early-stage breast cancer.
17214356 Observational study of gene-disease association. (HuGE Navigator)
17178848 tumor cells exposed to DNA damage counteract cell death by releasing the antiapoptotic protein, survivin, from mitochondria, which reauires activated checkpoint kinase 2 (Chk2.
17169815 no significant association between CHEK2*1100delC and familial or sporadic chronic lymphocytic leukemia
17164383 Observational study of gene-disease association. (HuGE Navigator)
17164260 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17164260 Common variants in the ATM and CHEK2 genes, in interaction with oestrogen-related exposures, are involved in endometrial cancer aetiology.
17145815 Loss of heterozygosity (LOH) across the CHEK2 locus is common in sporadic breast, ovarian, and colorectal cancers, but point mutation or epigenetic inactivation of the retained allele is uncommon.
17132695 Observational study of gene-disease association. (HuGE Navigator)
17132695 CHEK2*1100delC carriers have an increased risk of second breast cancer and a worse long-term recurrence-free survival rate
17132159 Observational study of gene-disease association. (HuGE Navigator)
17113724 Observational study of genotype prevalence. (HuGE Navigator)
17106448 Observational study of gene-disease association. (HuGE Navigator)
17106448 I157T mutation increases the risk of colorectal cancer in the population; truncating mutations may confer a lower risk or no increase in risk.
17101782 These results identify a novel role for FoxM1 in the transcriptional response during DNA damage/checkpoint signaling and show a novel mechanism by which Chk2 protein regulates expression of DNA repair enzymes.
17085682 Observational study of gene-disease association. (HuGE Navigator)
17085682 A large deletion of exons 9 and 10 of CHEK2 confers an increased risk of prostate cancer.
17040931 Observational study of gene-disease association. (HuGE Navigator)
17030982 The response of promyelocytic leukemia nuclear bodies to DNA double-strand breaks is regulated by NBS1, ATM, Chk2, and ATR.
17026620 hereditary breast and colorectal cancer syndrome, if it exists as a separate entity, is not likely to be due to CHEK2 mutations
17010071 Observational study of gene-disease association. (HuGE Navigator)
17010071 Germ line mutation in checkpoint kinase 2 is associated with breast cancer patients with a positive estrogen receptor status
16998506 Defects may predispose to tumors, with particular emphasis on familial breast cancer. [REVIEW]
16998498 Breast tumors carrying a mutation in CHEK2 are rare and show contradictory results, probably due to the low number of these cases. [REVIEW]
16983346 Vpr-dependent induction and Vif-mediated attenuation of NKG2D ligands are required for Chk2 phosphorylation in HIV infection
16943424 These results demonstrate a sophisticated control by ATM of a target protein, Hdmx, which itself is one of several ATM targets in the ATM-p53 axis of the DNA damage response.
16941491 Data suggest that the CHEK2 and TP53 mutations can substitute each other in at least 25% (21/84) of prostate cancers and that DNA damage-signaling pathway plays an important role in prostate cancer tumorigenesis.
16940182 Results underscore the critical roles of S19, S33, and S35 and argue that these phosphoresidues may serve to fine-tune the ATM-dependent response of Chk2 to increasing amounts of DNA damage.
16936775 These results indicate that Wip1 is one of the phosphatases regulating the activity of Chk2 in response to DNA damage.
16914568 Observational study of gene-disease association. (HuGE Navigator)
16914568 Three founder alleles in CHEK2 contribute to early-onset breast cancer in Poland. Breast tumors which arise in carriers of CHEK2 mutations seem to be similar to those of breast cancers in the population at large.
16905549 Mre11 stabilizes Nbs1 and Rad50 and MRN activates Chk2 downstream from ATM in response to replication-mediated DNA double strand breaks
16883537 CHEK2 c.1100delC is rare variant for Chinese population and may not contribute to predisposition for hereditary breast cancer in Shanghai.
16883537 Observational study of gene-disease association. (HuGE Navigator)
16880452 Observational study of gene-disease association. (HuGE Navigator)
16880452 CHEK2*1100delC heterozygosity is associated with a three-fold risk of breast cancer in women in the general population
16858628 Observational study of genotype prevalence. (HuGE Navigator)
16858628 Given the low expected mutation rate of up to 1.4% for CHEK2 * 1100delC in the European population the data are suggestive for possible contribution of CHEK2 mutations to a small subset of Familial pancreatic cancer.
16835864 Germ-line and somatic mutations that affect the kinase activity of CHEK2 are associated with the development of prostate cancer.
16835227 Data demonstrate that PML (promyelocytic leukemia)interacts with Chk2 and activates Chk2 by mediating its autophosphorylation step.
16830057 Observational study of genotype prevalence. (HuGE Navigator)
16828850 Observational study of gene-disease association. (HuGE Navigator)
16816021 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16816021 A functionally defective CHEK2 variant associates with an increased risk of colorectal cancer.
16798742 an intrinsic kinase activity of Chk2, but not phosphatase activity of Wip1, is required for the association of fulllength Chk2 and Wip1
16790090 deregulation of CHEK2 and/or PPP2R2A is of pathogenetic importance in at least a subset of germ cell tumors
16758118 Observational study of gene-disease association. (HuGE Navigator)
16758118 High relevance of the 1100delC variant for breast cancer predisposition in Russia
16741947 ATR is one of the kinases that is likely involved in phosphorylation of Chk2 in response to ionizing radiation when ATM is deficient.
16732333 CHK2-depleted cells do not exhibit chromosome instability or common fragile site breaks.
16705183 The activation of ATM/ATR/CHK signaling pathways contributes to this G2 checkpoint and highlight the interrelated roles of p14ARF and the Tip60 protein in the initiation of this DNA damage-signaling cascade.
16671833 Observational study of gene-disease association. (HuGE Navigator)
16671833 Notwithstanding the involvement of the CHEK2 gene in breast cancer aetiology, we show that common polymorphisms do not influence postmenopausal breast cancer risk.
16574953 Observational study of gene-disease association. (HuGE Navigator)
16574953 Preeminent associations were identified in SNPs mapping to genes pivotal in the DNA damage-response and cell-cycle pathways, including ATM F858L and P1054R, CHEK2 I157T, BRCA2 N372H, and BUB1B Q349R.
16539695 Observational study of gene-disease association. (HuGE Navigator)
16539695 CHEK2 1100delC is not a major cause of double primary breast and colorectal cancer in Sweden.
16492927 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16492927 Our results support the hypothesis that carrier status for CHEK2*1100delC is associated with increased breast cancer risk and suggest that this relationship may be modified by other factors, such as radiation exposure.
16481012 Plk3 is in a pathway linking ATM, Plk3, Chk2, Cdc25C and Cdc2 in cellular response to DNA damage.
16452051 Observational study of gene-disease association. (HuGE Navigator)
16452051 CHEK2 protein mutation is not clinically important high risk gene for hereditary prostate cancer susceptibility in the population of Southern Sweden.
16437383 Chk2 correlated with reduced expression of h-TERT and p27, but not with angiogenic factors in breast cancer; Chk2 expression also did not interfere in the outcome of the patients
16414312 Gene repair directed by oligonucleotides activates a pathway that prevents corrected cells from proliferating in cell culture through the activation of Chk1 and Chk2.
16337852 determination as to the role of CHEK2 1100delC mutation in enhanced chromosomal radiosensitivity in breast cancer patients
16317088 p53-independent role for Chk2 in p21 induction and senescence that may contribute to tumor suppression
16311512 Chk2 kinase was regualted by the oncogenic Wip1 phosphatase.
16257342 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16239104 Observational study of gene-disease association. (HuGE Navigator)
16078115 a role of CHEK2 in the pathway of alternative TP53 inactivation in primary glioblastoma.
16043347 Observational study of gene-disease association. (HuGE Navigator)
15987456 Observational study of gene-disease association. (HuGE Navigator)
15980987 Observational study of gene-disease association. (HuGE Navigator)
15964795 Mutations in proline 82 of p53 impair its activation by PIN1 and CHK2 in response to DNA damage.
15942682 results suggest that aberrations of the CHK2 gene are rare in pediatric solid tumors
15876876 Plk1 Polo box domain mediates a cell cycle and DNA damage regulated interaction with Chk2
15862297 HDM2 negatively affects the Chk2-mediated phosphorylation of p53.
15852425 Observational study of gene-disease association. (HuGE Navigator)
15852425 results are consistent with a low-penetrance effect (OR 1.5-2.0) of the CHEK2 1100delC on CRC risk.
15818573 Observational study of gene-disease association. (HuGE Navigator)
15810020 Observational study of gene-disease association. (HuGE Navigator)
15803365 CHEK2 mutations may be associated with specific histologic subtypes of breast cancer in Polish women. I157T missense mutation was strongly associated with lobular carcinoma.
15803363 Observational study of gene-disease association. (HuGE Navigator)
15803363 CHEK2 germline mutation rarely contributes to breast cancer development in the Czech Republic
15700044 Compensation of the 1100delC defect in CHEK2 might explain the rather low breast cancer risk associated with the CHEK2 variant, compared to that associated with truncating mutations in BRCA1 or BRCA2
15694385 Therefore, these results are the first to indicate a novel mechanism of regulating Chk2 in cisplatin-induced resistance of cancer cells.
15668230 DNA-PK augments ATM and ATR in activation of Chk2 by DNA damage.
15659650 possible interplay between tumor protein p53 C-terminal phosphorylation and acetylation, and they provide an additional mechanism for the control of the activity of p53 by Checkpoint kinase 1 and Checkpoint kinase 2
15649950 Observational study of gene-disease association. (HuGE Navigator)
15649950 Mutations in CHEK2 is associated with breast cancer
15647386 Chk1 and Chk2 have roles in mismatch repair-dependent G2 arrest
15618221 TTK functions upstream from CHK2 in response to DNA damage
15601819 Chk1 and Chk2 control the induction of the p53 related transcription factor p73 in response to DNA damage.
15535844 Observational study of gene-disease association. (HuGE Navigator)
15492928 Observational study of gene-disease association. (HuGE Navigator)
15488637 Observational study of genotype prevalence. (HuGE Navigator)
15472904 Observational study of gene-disease association. (HuGE Navigator)
15472904 CHEK2 germ line mutation is associated with bilateral breast cancer
15467464 in the human orthologue of Cds1, CHK2, differential splicing of a cryptic exon leads to a frame shift and premature termination producing a short variant (SvCHK2).
15466005 Observational study of gene-disease association. (HuGE Navigator)
15466005 carrying the CHEK2*1100delC mutation is an adverse prognostic indicator for breast cancer
15385111 Observational study of gene-disease association. (HuGE Navigator)
15361853 some splice variants lack CHK2 function and/or localize aberrantly
15361851 the otherwise dormant Chk2 is aberrantly and constitutively activated in invasive urinary bladder carcinomas
15361830 Chk2 activity is triggered by a greater number of double strand breaks, implying that, below a certain threshold level of lesions, DNA repair can occur through ATM, without enforcing Chk2-dependent checkpoints.
15239132 Observational study of gene-disease association. (HuGE Navigator)
15192702 CHK2 triggers replicative senescence.
15122511 Observational study of gene-disease association. (HuGE Navigator)
15122511 CHEK2*1100delC confers an increased risk of breast cancer
15095295 Observational study of gene-disease association. (HuGE Navigator)
15095295 there is a limited relevance for CHEK2 mutations in familial breast cancer
15087378 Observational study of gene-disease association. (HuGE Navigator)
15087378 Two truncating mutations of CHEK2 confer a moderate risk of prostate cancer in Polish men and that the missense change appears to confer a modest risk.
15057041 Observational study of gene-disease association. (HuGE Navigator)
15048074 Down regulation of Cdk1/cyclin B is secondary to the activation of Chk2. A conflict in cell cycle progression or DNA damage can lead to mitotic catastrophe, provided that the checkpoint kinase Chk2 is inhibited.
15044452 p53 negatively regulates Chk2 gene transcription through modulation of NF-Y function and that this regulation may be important for reentry of cells into the cell cycle after DNA damage is repaired.
15024084 Results suggest that E2F1 plays a central role in signaling disturbances in the retinoblastoma growth control pathway and, by upregulation of Chk2 by Atm and Nbs1, may sensitize cells to undergo apoptosis.
14997059 Observational study of gene-disease association. (HuGE Navigator)
14970869 Observational study of gene-disease association. (HuGE Navigator)
14701743 functional link between recombination control and breast cancer predisposition in carriers of Chk2 and BRCA1 germ line mutations
14681223 data reveal the very different mode of regulation between CHK1 and CHK2
14678969 Observational study of gene-disease association. (HuGE Navigator)
14648717 Observational study of gene-disease association. (HuGE Navigator)
14612911 Observational study of gene-disease association. (HuGE Navigator)
14612911 CHEK2 variants are low-penetrance prostate cancer predisposition alleles that contribute significantly to familial clustering of prostate cancer at the population level
14568168 Observational study of gene-disease association. (HuGE Navigator)
14568168 The CHEK2 1100delC allele was not over-represented in cases suggesting that this variant is not associated with an increased risk of colorectal disease.
14514889 Zinc-finger protein transcription factors bind an 18-bp recognition sequence within the promoter of the endogenous CHK2 gene, giving a >10-fold reduction in CHK2 mRNA and protein
14507240 Observational study of gene-disease association. (HuGE Navigator)
14507240 study from South India, on BRCA1, BRCA2 & CHEK2 mutations in patients with a family history of breast and/or ovarian cancer and early onset breast/ovarian cancer
12917215 Observational study of gene-disease association. (HuGE Navigator)
12909615 the NLS-3 motif located at amino acids 515-522 acts indeed as Nuclear Localization Signal for Chk2
12897801 evidence that CHK2 can be activated allosterically towards some substrates by a novel docking interaction; identifed a potential regulatory switch that may channel CHK2 into distinct signalling pathways in vivo
12855706 Chk2 autophosphorylation is critical for Chk2 function following DNA damage
12810724 chk2 is recruited into the PML nuclear bodies by PML along with p53
12805407 autophosphorylation of Chk2 can occur both in cis and in trans and suggest that oligomerization may regulate Chk2 activation by promoting these cis- and trans-phosphorylation events
12717439 Expression of a dominant-negative Chk2 mutant blocks induction of E2F-1 and prevents E2F-1-dependent apoptosis. Moreover, E2F-1 is resistant to induction by etoposide in tumour cells expressing mutant chk2.
12711320 Determination of substrate specificity and putative substrates of Chk2 kinase.
12690581 The 1100delC variant of the CHEK2 gene was present in 18% of 55 families with hereditary breast and colorectal cancer (HBCC) as compared with 4% of 380 families with non-HBCC and may act in synergy with unknown susceptibility gene(s)
12676583 Increased phosphate incorporation into serine residues generated by the combined action of CHK1 and CHK2 kinases correlated with the ionizing radiation-induced acceleration of Cdc25A proteolysis.
12654917 Chk2 kinase is not required for p53 activation in human cells and explain why CHK2 and TP53 mutations can jointly occur in human tumors.
12654916 although Chk2 purified from DNA damage sustaining cells has dramatically increased ability to phosphorylate Cdc25C when compared with untreated cells, its ability to phosphorylate p53 is weak
12610780 Variations in this enzyme other than 1100delC do not make a major contribution to breast cancer susceptibility.
12607004 MDC1 is recruited through its FHA domain to the activated CHK2, and has a critical role in CHK2-mediated DNA damage responses
12551934 Chk2 is regulated by NFBD1 and 53BP1 in human tumor cells
12548019 Plk3 is rapidly activated by reactive oxygen species fibroblasts cells, correlating with increased p53 protein levels. Plk3 physically interacts with Chk2 and the interaction is enhanced upon DNA damage.
12533788 Mutations and CHEK2 protein levels were analyzed in prostatic neoplasms. CHEK2 mutations contributed to prostate cancer risk.
12529183 Observational study of gene-disease association. (HuGE Navigator)
12493754 interaction with polo-like kinase 1 and localization to centrosomes and midbody
12454775 Observational study of gene-disease association. (HuGE Navigator)
12402044 checkpoint kinase hCds1/Chk2 has a role in regulating PML-dependent apoptosis after DNA damage
12393693 CHK2 alterations are uncommon in malignant lymphomas but occur in a subset of aggressive tumors. The high number of chromosomal imbalances in tumors with complete absence of CHK2 protein suggests a role in chromosomal instability in human lymphomas.
12386164 phosphorylation of Thr-68 may be required for initial oligomerization and activation of Chk2, but it is not needed for maintenance of dimerization or kinase activity
12111733 function and regulation of Cds1 - review
12094328 mutation is associated with familial breast cancer
12049740 Although phospho-dependent binding is important for Chk2 activity, previously uncharacterized phospho-independent FHA domain interactions appear to be the primary target of oncogenic lesions.
12024051 results suggest that Chk2 oligomerization regulates Chk2 activation, signal amplification, and transduction in DNA damage checkpoint pathways
11984555 CHEKs and balances: accounting for breast cancer.
11967536 Observational study of genotype prevalence. (HuGE Navigator)
11967536 Low-penetrance susceptibility to breast cancer due to CHEK2(*)1100delC in noncarriers of BRCA1 or BRCA2 mutations.
11901158 Phosphorylation of threonine 68 promotes oligomerization and autophosphorylation of the Chk2 protein kinase via the forkhead-associated domain
11875739 genetic changes in CHK2 occur in small proportion of vulval squamous cell carcinomas
11821419 utilization of peptide library analyses to develop specific, highly preferred substrate motifs for hCds1/Chk2 and Chk1
11793476 robust method for detecting CHK2/RAD53 mutations in genomic DNA
11751432 Observational study of gene-disease association. (HuGE Navigator)
11746983 Mutations of the CHK2 gene are found in some osteosarcomas, but are rare in breast, lung, and ovarian tumors.
11719428 Destabilization of CHK2 by a missense mutation associated with Li-Fraumeni Syndrome.
11461078 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQE      1 - 70
LYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYS     71 - 140
KKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQS    141 - 210
VYPKALRDEYIMSKTLGSGACGEVKLAFERKTCKKVAIKIISKRKFAIGSAREADPALNVETEIEILKKL    211 - 280
NHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKP    281 - 350
ENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFIC    351 - 420
LSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDED    421 - 490
MKRKFQDLLSEENESTALPQVLAQPSTSRKRPREGEAEGAETTKRPAVCAAVL                     491 - 543
//

Text Mined References (461)

PMID Year Title
26991782 2016 A Comparison between CHEK2*1100delC/I157T Mutation Carrier and Noncarrier Breast Cancer Patients: A Clinicopathological Analysis.
26831064 2016 CHK2-BRCA1 tumor-suppressor axis restrains oncogenic Aurora-A kinase to ensure proper mitotic microtubule assembly.
26577449 2015 BRCA1, BRCA2 and PALB2 mutations and CHEK2 c.1100delC in different South African ethnic groups diagnosed with premenopausal and/or triple negative breast cancer.
26573794 2015 Checkpoint Kinase 2 Negatively Regulates Androgen Sensitivity and Prostate Cancer Cell Growth.
26553136 2015 Genomic profiling of CHEK2*1100delC-mutated breast carcinomas.
26506619 2015 Association of Germline CHEK2 Gene Variants with Risk and Prognosis of Non-Hodgkin Lymphoma.
26483394 2016 Prevalence of Pathogenic Mutations in Cancer Predisposition Genes among Pancreatic Cancer Patients.
26447757 2015 Repurposing of nitroxoline as a potential anticancer agent against human prostate cancer: a crucial role on AMPK/mTOR signaling pathway and the interplay with Chk2 activation.
26424751 2015 Common variants at the CHEK2 gene locus and risk of epithelial ovarian cancer.
26084796 2016 The germline mutations of the CHEK2 gene are associated with an increased risk of polycythaemia vera.
26083025 2015 Prevalence of Germline Mutations in Genes Engaged in DNA Damage Repair by Homologous Recombination in Patients with Triple-Negative and Hereditary Non-Triple-Negative Breast Cancers.
26061604 2015 Mangrove dolabrane-type of diterpenes tagalsins suppresses tumor growth via ROS-mediated apoptosis and ATM/ATR-Chk1/Chk2-regulated cell cycle arrest.
26054341 2015 Combined inhibition of the cell cycle related proteins Wee1 and Chk1/2 induces synergistic anti-cancer effect in melanoma.
26025911 2015 Initiation of the ATM-Chk2 DNA damage response through the base excision repair pathway.
25962492 2015 SHP-1 overexpression increases the radioresistance of NPC cells by enhancing DSB repair, increasing S phase arrest and decreasing cell apoptosis.
25958056 2015 Sensitivity to systemic therapy for metastatic breast cancer in CHEK2 1100delC mutation carriers.
25884806 2015 Association between CHEK2 H371Y mutation and response to neoadjuvant chemotherapy in women with breast cancer.
25872745 2015 Hepatitis B virus X protein activates the ATM-Chk2 pathway and delays cell cycle progression.
25850293 [Genotyping of BRCA1, BRCA2 and CHEK2 germline mutations in Russian breast cancer patients using diagnostic biochips].
25842825 [Frequency of CHEK2 gene mutations in patients with breast cancer from the Republic of Bashkortostan].
25835597 2015 CHEK2 c.1100delC allele is rarely identified in Greek breast cancer cases.
25773391 2015 MicroRNA-191 promotes osteosarcoma cells proliferation by targeting checkpoint kinase 2.
25640309 2015 Systematic identification of molecular links between core and candidate genes in breast cancer.
25629968 2015 Low prevalence of CHEK2 gene mutations in multiethnic cohorts of breast cancer patients in Malaysia.
25619829 2015 A novel recurrent CHEK2 Y390C mutation identified in high-risk Chinese breast cancer patients impairs its activity and is associated with increased breast cancer risk.
25583358 2015 CHEK2 mutations and the risk of papillary thyroid cancer.
25531207 2015 Activation of checkpoint kinase 2 is critical for herpes simplex virus type 1 replication in corneal epithelium.
25483076 2014 Checkpoint kinase 2 is required for efficient immunoglobulin diversification.
25449779 2015 A pathway-based approach for identifying biomarkers of tumor progression to trastuzumab-resistant breast cancer.
25425972 2014 Clinicopathological significance of ATM-Chk2 expression in sporadic breast cancers: a comprehensive analysis in large cohorts.
25414026 2014 Breast cancer sensitivity to neoadjuvant therapy in BRCA1 and CHEK2 mutation carriers and non-carriers.
25404613 2014 CHK2 kinase in the DNA damage response and beyond.
25361978 2014 Chk2 and REG?-dependent DBC1 regulation in DNA damage induced apoptosis.
25355026 2014 Breast cancer risk associated with CHEK2 mutations.
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
25129146 2014 Joint analysis of three genome-wide association studies of esophageal squamous cell carcinoma in Chinese populations.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24998580 2014 Lack of CHEK2 gene mutations in differentiated thyroid carcinoma patients using high resolution melting analysis.
24986639 2014 First evidence of a large CHEK2 duplication involved in cancer predisposition in an Italian family with hereditary breast cancer.
24976383 2014 Increased microtubule assembly rates influence chromosomal instability in colorectal cancer cells.
24918820 2014 Survival and contralateral breast cancer in CHEK2 1100delC breast cancer patients: impact of adjuvant chemotherapy.
24880342 2014 Rare variants of large effect in BRCA2 and CHEK2 affect risk of lung cancer.
24879340 2014 Identification of two poorly prognosed ovarian carcinoma subtypes associated with CHEK2 germ-line mutation and non-CHEK2 somatic mutation gene signatures.
24853623 2014 Co-abrogation of Chk1 and Chk2 by potent oncolytic adenovirus potentiates the antitumor efficacy of cisplatin or irradiation.
24825908 2014 Collaborator of ARF (CARF) regulates proliferative fate of human cells by dose-dependent regulation of DNA damage signaling.
24798733 2014 Chk2 prevents mitotic exit when the majority of kinetochores are unattached.
24764296 2014 Phosphorylation at threonine 288 by cell cycle checkpoint kinase 2 (CHK2) controls human monopolar spindle 1 (Mps1) kinetochore localization.
24662822 2015 DNA-PK/Chk2 induces centrosome amplification during prolonged replication stress.
24657486 2014 Checkpoint kinase 2 (Chk2) supports sensitivity to platinum-based treatment in high grade serous ovarian cancer.
24599715 2014 Variants in the ATM-CHEK2-BRCA1 axis determine genetic predisposition and clinical presentation of papillary thyroid carcinoma.
24557336 2014 Survival from breast cancer in patients with CHEK2 mutations.
24550317 2014 PARP1-dependent recruitment of KDM4D histone demethylase to DNA damage sites promotes double-strand break repair.
24532427 2014 Genetic association of CHEK2, GSTP1, and ERCC1 with glioblastoma in the Han Chinese population.
24498068 2014 Mitogen-induced B-cell proliferation activates Chk2-dependent G1/S cell cycle arrest.
24480460 2014 Aurora-A controls cancer cell radio- and chemoresistance via ATM/Chk2-mediated DNA repair networks.
24415413 2014 Development of breast tumors in CHEK2, NBN/NBS1 and BLM mutation carriers does not commonly involve somatic inactivation of the wild-type allele.
24390236 2014 Missense mutations (p.H371Y, p.D438Y) in gene CHEK2 are associated with breast cancer risk in women of Balochistan origin.
24065469 CHEK2 1100delC and Del5395bp mutations in BRCA-negative individuals from Serbian hereditary breast and ovarian cancer families.
24021642 2013 ?H2AX foci formation in the absence of DNA damage: mitotic H2AX phosphorylation is mediated by the DNA-PKcs/CHK2 pathway.
24002546 2013 Dihydromyricetin suppresses the proliferation of hepatocellular carcinoma cells by inducing G2/M arrest through the Chk1/Chk2/Cdc25C pathway.
23969480 2014 DNA damage response-related proteins in gastric cancer: ATM, Chk2 and p53 expression and their prognostic value.
23821772 2013 A kinetic test characterizes kinase intramolecular and intermolecular autophosphorylation mechanisms.
23806170 2013 Constitutional CHEK2 mutations are infrequent in early-onset and familial breast/ovarian cancer patients from Pakistan.
23803109 2013 Identification of a novel BRCA2 and CHEK2 A-C-G-C haplotype in Turkish patients affected with breast cancer.
23713947 2013 The effect of CHEK2 variant I157T on cancer susceptibility: evidence from a meta-analysis.
23690919 2013 The co-repressor SMRT delays DNA damage-induced caspase activation by repressing pro-apoptotic genes and modulating the dynamics of checkpoint kinase 2 activation.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23449389 2013 The E3 ligase PIRH2 polyubiquitylates CHK2 and regulates its turnover.
23415889 2013 Excess breast cancer risk in first degree relatives of CHEK2?1100delC positive familial breast cancer cases.
23333640 2013 The inhibition of HIF-2? on the ATM/Chk-2 pathway is involved in the promotion effect of arsenite on benzo(a)pyrene-induced cell transformation.
23329222 2012 CHEK2 1100DELC germline mutation: a frequency study in hereditary breast and colon cancer Brazilian families.
23296741 2013 The risk of gastric cancer in carriers of CHEK2 mutations.
23269272 2013 MYC regulation of CHK1 and CHK2 promotes radioresistance in a stem cell-like population of nasopharyngeal carcinoma cells.
23178491 2014 CHK2 kinase promotes pre-mRNA splicing via phosphorylating CDK11(p110).
23150219 2013 CHEK2 c.1100delC mutation among non-BRCA1/2 Spanish hereditary breast cancer families.
23109706 2012 CHEK2*1100delC heterozygosity in women with breast cancer associated with early death, breast cancer-specific death, and increased risk of a second breast cancer.
23107771 2013 CHK2 1100delC, IVS2+1G>A and I157T mutations are not present in hepatocellular cancer cases from a Turkish population.
23073808 2012 The role of DNA damage repair and Chk2 protein in hyper-radiosensitivity of lung adenocarcinoma A549 cells.
22994785 2012 CHEK2 1100delC variant and breast cancer risk in Caucasians: a meta-analysis based on 25 studies with 29,154 cases and 37,064 controls.
22960999 2012 Genome-wide association analyses of esophageal squamous cell carcinoma in Chinese identify multiple susceptibility loci and gene-environment interactions.
22946335 2012 [Prevalence of mutations BRCA1 5382insC, and CHEK2 1100delC in the population of Siberian region].
22901170 2012 The CHEK2 I157T variant and colorectal cancer susceptibility: a systematic review and meta-analysis.
22862163 2012 CHEK2 gene alterations independently increase the risk of death from breast cancer in Bulgarian patients.
22851694 2012 Nek4 regulates entry into replicative senescence and the response to DNA damage in human fibroblasts.
22811390 2013 BRCA1, TP53, and CHEK2 germline mutations in uterine serous carcinoma.
22808196 2012 Increases in mitochondrial DNA content and 4977-bp deletion upon ATM/Chk2 checkpoint activation in HeLa cells.
22799331 2012 The CHEK2 I157T variant and breast cancer susceptibility: a systematic review and meta-analysis.
22770119 2013 Titanium dioxide nanoparticles activate the ATM-Chk2 DNA damage response in human dermal fibroblasts.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22658458 2012 Multiplexed protein signal pathway mapping identifies patients with rectal cancer that responds to neoadjuvant treatment.
22586065 2012 Chk2 phosphorylation of survivin-DeltaEx3 contributes to a DNA damage-sensing checkpoint in cancer.
22521562 2012 CHEK2 1100delC, IVS2+1G>A and I157T mutations are not present in colorectal cancer cases from Turkish population.
22420423 2012 Low expression levels of ATM may substitute for CHEK2 /TP53 mutations predicting resistance towards anthracycline and mitomycin chemotherapy in breast cancer.
22419737 2012 Response to DNA damage of CHEK2 missense mutations in familial breast cancer.
22355270 2012 Alternative splicing of CHEK2 and codeletion with NF2 promote chromosomal instability in meningioma.
22294770 2012 Investigation of the effects of DNA repair gene polymorphisms on the risk of colorectal cancer.
22266820 2012 The E3 ligase RNF8 regulates KU80 removal and NHEJ repair.
22211259 2012 Structural delineation of MDC1-FHA domain binding with CHK2-pThr68.
22201027 2012 Variant allele of CHEK2 is associated with a decreased risk of esophageal cancer lymph node metastasis in a Chinese population.
22160829 2012 Widdrol activates DNA damage checkpoint through the signaling Chk2-p53-Cdc25A-p21-MCM4 pathway in HT29 cells.
22159226 2012 Orphan receptor TR3 participates in cisplatin-induced apoptosis via Chk2 phosphorylation to repress intestinal tumorigenesis.
22158418 2012 Chk2 mediates RITA-induced apoptosis.
22114986 2011 CHEK2 contribution to hereditary breast cancer in non-BRCA families.
22072393 2012 Gene-gene interactions in breast cancer susceptibility.
22071692 2011 Phosphorylation of von Hippel-Lindau protein by checkpoint kinase 2 regulates p53 transactivation.
22058428 2011 CHEK2*1100delC homozygosity is associated with a high breast cancer risk in women.
22058216 2012 A risk of essential thrombocythemia in carriers of constitutional CHEK2 gene mutations.
21956126 2012 CHEK2*1100delC and risk of malignant melanoma: Danish and German studies and meta-analysis.
21945852 2011 Chk2-mediated G2/M cell cycle arrest maintains radiation resistance in malignant meningioma cells.
21924579 2011 Ethanol metabolism activates cell cycle checkpoint kinase, Chk2.
21907711 2011 X-ray structures of checkpoint kinase 2 in complex with inhibitors that target its gatekeeper-dependent hydrophobic pocket.
21876083 2011 Risk of breast cancer in women with a CHEK2 mutation with and without a family history of breast cancer.
21807500 2011 Meta-analysis of CHEK2 1100delC variant and colorectal cancer susceptibility.
21787115 2011 CHEK2, MGMT, SULT1E1 and SULT1A1 polymorphisms and endometrial cancer risk.
21772273 2011 Functional and molecular interactions between ERK and CHK2 in diffuse large B-cell lymphoma.
21765476 2012 CHEK2 genomic and proteomic analyses reveal genetic inactivation or endogenous activation across the 60 cell lines of the US National Cancer Institute.
21744992 2011 Alterations of CHEK2 forkhead-associated domain increase the risk of Hodgkin lymphoma.
21701879 2012 Different CHEK2 germline mutations are associated with distinct immunophenotypic molecular subtypes of breast cancer.
21618645 2011 A recurrent CHEK2 p.H371Y mutation is associated with breast cancer risk in Chinese women.
21614566 2012 Gene expression profiling assigns CHEK2 1100delC breast cancers to the luminal intrinsic subtypes.
21562711 2011 Two new CHEK2 germ-line variants detected in breast cancer/sarcoma families negative for BRCA1, BRCA2, and TP53 gene mutations.
21356067 2011 Screening for BRCA1, BRCA2, CHEK2, PALB2, BRIP1, RAD50, and CDH1 mutations in high-risk Finnish BRCA1/2-founder mutation-negative breast and/or ovarian cancer individuals.
21317874 2011 Global dissociation of HuR-mRNA complexes promotes cell survival after ionizing radiation.
21269460 2011 Initial characterization of the human central proteome.
21244692 2011 Rare, evolutionarily unlikely missense substitutions in CHEK2 contribute to breast cancer susceptibility: results from a breast cancer family registry case-control mutation-screening study.
21184685 2010 The checkpointkinase 2 (CHK2) 1100delC germ line mutation is not associated with the development of squamous cell carcinoma of the head and neck (SCCHN).
21156285 2010 Loss of ATM/Chk2/p53 pathway components accelerates tumor development and contributes to radiation resistance in gliomas.
21118956 2011 A novel Chk1/2-Lats2-14-3-3 signaling pathway regulates P-body formation in response to UV damage.
21070773 2010 Per3, a circadian gene, is required for Chk2 activation in human cells.
21034966 2010 The ATM-Chk2 and ATR-Chk1 pathways in DNA damage signaling and cancer.
20875877 2010 Absence of CHEK2*1100delC mutation in families with hereditary breast cancer in North America.
20731661 2010 Comprehensive analysis of DNA repair gene polymorphisms and survival in patients with early stage non-small-cell lung cancer.
20729852 2010 A shared susceptibility locus in PLCE1 at 10q23 for gastric adenocarcinoma and esophageal squamous cell carcinoma.
20722467 2010 Evaluation of the contribution of the three breast cancer susceptibility genes CHEK2, STK11, and PALB2 in non-BRCA1/2 French Canadian families with high risk of breast cancer.
20713355 2010 Interdependent phosphorylation within the kinase domain T-loop Regulates CHK2 activity.
20668524 2010 Role of the ATM-checkpoint kinase 2 pathway in CDT-mediated apoptosis of gingival epithelial cells.
20658728 CHEK2 I157T and colorectal cancer in Bulgaria.
20644561 2011 A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer.
20643596 2010 CHEK2 gene alterations in the forkhead-associated domain, 1100delC and del5395 do not modify the risk of sporadic pancreatic cancer.
20599567 2010 A protein phosphatase feedback mechanism regulates the basal phosphorylation of Chk2 kinase in the absence of DNA damage.
20581449 2010 Centrosomal Chk2 in DNA damage responses and cell cycle progression.
20548946 2010 A genome-wide association study of optic disc parameters.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20472656 2010 BRCA1, BRCA2 and CHEK2 c.1100 delC mutations in patients with double primaries of the breasts and/or ovaries.
20462940 2010 A variant in the CHEK2 promoter at a methylation site relieves transcriptional repression and confers reduced risk of lung cancer.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20442702 2010 A mitotic role for the DNA damage-responsive CHK2 kinase.
20434834 2010 Chk2*1100delC Acts in synergy with the Ron receptor tyrosine kinase to accelerate mammary tumorigenesis in mice.
20417869 2010 A simple method of investigating mutations in CHEK2 by DHPLC: a study of the German populations of Saxony, Saxony-Anhalt, and Thuringia.
20364141 2010 The CHK2-BRCA1 tumour suppressor pathway ensures chromosomal stability in human somatic cells.
20306497 2010 Single-nucleotide polymorphisms in the p53 pathway genes modify cancer risk in BRCA1 and BRCA2 carriers of Jewish-Ashkenazi descent.
20204303 2010 Anti-leukaemic effects of two extract types of Lactuca sativa correlate with the activation of Chk2, induction of p21, downregulation of cyclin D1 and acetylation of alpha-tubulin.
20200249 2010 Regulation of Epstein-Barr virus origin of plasmid replication (OriP) by the S-phase checkpoint kinase Chk2.
20159774 2010 A DNA damage-activated checkpoint kinase phosphorylates tau and enhances tau-induced neurodegeneration.
20080130 2010 Chk2 splice variants express a dominant-negative effect on the wild-type Chk2 kinase activity.
20023427 2010 A role for Chk2 in DNA damage induced mitotic delays in human colorectal cancer cells.
20023412 2010 DNA damage signaling is activated during cancer progression in human colorectal carcinoma.
19996108 2010 Mammalian TIMELESS is required for ATM-dependent CHK2 activation and G2/M checkpoint control.
19922265 2010 Topoisomerase inhibitor coralyne photosensitizes DNA, leading to elicitation of Chk2-dependent S-phase checkpoint and p53-independent apoptosis in cancer cells.
19881958 2009 Naphthalimides induce G(2) arrest through the ATM-activated Chk2-executed pathway in HCT116 cells.
19876921 2010 CHEK2 mutations and HNPCC-related colorectal cancer.
19863560 2009 The contribution of founder mutations to early-onset breast cancer in French-Canadian women.
19840931 2009 Mitochondrial DNA damage initiates a cell cycle arrest by a Chk2-associated mechanism in mammalian cells.
19839522 2008 CHEK2 germline mutations correlate with recurrence rate in patients with superficial bladder cancer.
19798429 2009 Human papillomaviruses activate the ATM DNA damage pathway for viral genome amplification upon differentiation.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19782031 2009 Structure and activation mechanism of the CHK2 DNA damage checkpoint kinase.
19772467 2009 Chk2 protects against radiation-induced genomic instability.
19768534 2010 A novel germline CHEK2 deletion truncating the kinase domain identified in a French family with high-risk of breast/ovarian cancer.
19763819 2010 Evaluation of variants in the CHEK2, BRIP1 and PALB2 genes in an Irish breast cancer cohort.
19714462 2010 Genetic variation in genes interacting with BRCA1/2 and risk of breast cancer in the Cypriot population.
19656415 2009 Molecular genetics analysis of hereditary breast and ovarian cancer patients in India.
19615254 2009 [Down-regulation of Chk1/Chk2 gene expression increases apoptosis in irradiated HeLa cells and its mechanism].
19609724 2009 Haplotypes of the I157T CHEK2 germline mutation in ethnically diverse populations.
19597488 2009 Persistent DNA damage signalling triggers senescence-associated inflammatory cytokine secretion.
19548527 [Analysis of K-ras, BRCA1/2, CHEK2 mutations and microsatellite markers (loss of heterozygosity at 9p, 17p and 18q) in sporadic pancreas adenocarcinomas].
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19480937 2009 Recurrent loss, but lack of mutations, of the SMARCB1 tumor suppressor gene in T-cell prolymphocytic leukemia with TCL1A-TCRAD juxtaposition.
19473886 2009 Taking the time to make important decisions: the checkpoint effector kinases Chk1 and Chk2 and the DNA damage response.
19453842 2009 Cellular effects of genotoxic stress and gene silencing of the checkpoint kinases in human oral cells.
19451272 2009 RAD51C facilitates checkpoint signaling by promoting CHK2 phosphorylation.
19401704 2009 Cancer risks in first-degree relatives of CHEK2 mutation carriers: effects of mutation type and cancer site in proband.
19399639 2009 CHEK2*1100delC does not contribute to risk to breast cancer among Malay, Chinese and Indians in Malaysia.
19375317 2009 The shelterin protein TRF2 inhibits Chk2 activity at telomeres in the absence of DNA damage.
19372713 2009 Age at onset of bilateral breast cancer, the presence of hereditary BRCA1, BRCA2, CHEK2 gene mutations and positive family history of cancer.
19362748 2009 Epigenetic inactivation of checkpoint kinase 2 gene in non-small cell lung cancer and its relationship with clinicopathological features.
19338683 2009 The contribution of CHEK2 to the TP53-negative Li-Fraumeni phenotype.
19338682 2009 High frequency of BRCA1, but not CHEK2 or NBS1 (NBN), founder mutations in Russian ovarian cancer patients.
19289404 2009 Short 42 degrees C heat shock induces phosphorylation and degradation of Cdc25A which depends on p38MAPK, Chk2 and 14.3.3.
19265784 2009 The association of cell cycle checkpoint 2 variants and kidney function: findings of the Family Blood Pressure Program and the Atherosclerosis Risk In Communities study.
19177012 2009 Pro-apoptotic function of checkpoint kinase-2 in syncytia elicited by the HIV-1 envelope.
19176998 2009 Mdm2 and PCAF increase Chk2 ubiquitination and degradation independently of their intrinsic E3 ligase activities.
19164942 2009 Polo-like kinase 4 phosphorylates Chk2.
19151762 2009 The cell cycle checkpoint kinase CHK2 mediates DNA damage-induced stabilization of TTK/hMps1.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19124502 2009 Family history, genetic testing, and clinical risk prediction: pooled analysis of CHEK2 1100delC in 1,828 bilateral breast cancers and 7,030 controls.
19116388 2009 A field synopsis on low-penetrance variants in DNA repair genes and cancer susceptibility.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19062161 2009 Silencing the Metallothionein-2A gene inhibits cell cycle progression from G1- to S-phase involving ATM and cdc25A signaling in breast cancer cells.
19030985 2009 Synergistic interaction of variants in CHEK2 and BRCA2 on breast cancer risk.
19021634 2009 Estrogen receptor status in CHEK2-positive breast cancers: implications for chemoprevention.
19020308 2009 Zalypsis: a novel marine-derived compound with potent antimyeloma activity that reveals high sensitivity of malignant plasma cells to DNA double-strand breaks.
18996005 2009 The CHEK2 gene I157T mutation and other alterations in its proximity increase the risk of sporadic colorectal cancer in the Czech population.
18971944 2008 Chk2-dependent phosphorylation of XRCC1 in the DNA damage response promotes base excision repair.
18957425 2008 HTLV-1 Tax oncoprotein subverts the cellular DNA damage response via binding to DNA-dependent protein kinase.
18955500 2009 Death receptor-induced activation of the Chk2- and histone H2AX-associated DNA damage response pathways.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18948271 2008 Chk2 oligomerization studied by phosphopeptide ligation: implications for regulation and phosphodependent interactions.
18930998 2009 Effect of CHEK2 missense variant I157T on the risk of breast cancer in carriers of other CHEK2 or BRCA1 mutations.
18834326 2009 CHEK2 I157T and endometrial cancer.
18833288 2008 ATM and Chk2 kinase target the p53 cofactor Strap.
18812180 2008 Exploring the intramolecular phosphorylation sites in human Chk2.
18802408 2008 Phosphorylation of p53 on Ser15 during cell cycle caused by Topo I and Topo II inhibitors in relation to ATM and Chk2 activation.
18797466 2008 In vitro phosphorylation of BRCA2 by the checkpoint kinase CHEK2.
18759107 2009 CHEK2 1100delC and male breast cancer in the Netherlands.
18728393 2008 Nek6 is involved in G2/M phase cell cycle arrest through DNA damage-induced phosphorylation.
18725978 2008 CHEK2 mutations affecting kinase activity together with mutations in TP53 indicate a functional pathway associated with resistance to epirubicin in primary breast cancer.
18706089 2008 Identification of a novel CHEK2 variant and assessment of its contribution to the risk of breast cancer in French Canadian women.
18676774 2008 CHEK2 1100delC is a susceptibility allele for HNPCC-related colorectal cancer.
18667510 2008 The DNA damage sensors ataxia-telangiectasia mutated kinase and checkpoint kinase 2 are required for hepatitis C virus RNA replication.
18644861 2008 Regulation of Chk2 ubiquitination and signaling through autophosphorylation of serine 379.
18571837 2008 Identification and characterization of novel SNPs in CHEK2 in Ashkenazi Jewish men with prostate cancer.
18566483 2008 High-content fluorescent-based assay for screening activators of DNA damage checkpoint pathways.
18566216 2008 Chk1 and Chk2 are differentially involved in homologous recombination repair and cell cycle arrest in response to DNA double-strand breaks induced by camptothecins.
18557994 2008 Are the so-called low penetrance breast cancer genes, ATM, BRIP1, PALB2 and CHEK2, high risk for women with strong family histories?
18538787 2008 Autophosphorylated residues involved in the regulation of human chk2 in vitro.
18484200 2008 Breast cancer low-penetrance allele 1100delC in the CHEK2 gene: not present in the Chinese familial breast cancer population.
18482988 2008 Arsenic trioxide augments Chk2/p53-mediated apoptosis by inhibiting oncogenic Wip1 phosphatase.
18415014 2009 Genetic contribution to all cancers: the first demonstration using the model of breast cancers from Poland stratified by age at diagnosis and tumour pathology.
18381943 2008 Single-nucleotide polymorphisms of DNA damage response genes are associated with overall survival in patients with pancreatic cancer.
18381420 2008 Frequency of the CHEK2 1100delC mutation among women with breast cancer: an international study.
18321553 2008 Chk2 is required for HSV-1 ICP0-mediated G2/M arrest and enhancement of virus growth.
18317453 2008 The checkpoint kinases Chk1 and Chk2 regulate the functional associations between hBRCA2 and Rad51 in response to DNA damage.
18297428 2009 Deleterious CHEK2 1100delC and L303X mutants identified among 38 human breast cancer cell lines.
18281249 2008 Constitutional CHEK2 mutations are associated with a decreased risk of lung and laryngeal cancers.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
18253122 2008 Risk for contralateral breast cancer among carriers of the CHEK2*1100delC mutation in the WECARE Study.
18239682 2008 Activation segment dimerization: a mechanism for kinase autophosphorylation of non-consensus sites.
18178638 2008 Is CHEK2 a cause of the Li-Fraumeni syndrome?
18175216 2008 The CHEK2 1100delC mutation is not present in Korean patients with breast cancer cases tested for BRCA1 and BRCA2 mutation.
18172190 2008 CHEK2*1100delC genotyping for clinical assessment of breast cancer risk: meta-analyses of 26,000 patient cases and 27,000 controls.
18167186 2007 Mutation analysis of the checkpoint kinase 2 gene in colorectal cancer cell lines.
18162465 2008 ATR-Chk2 signaling in p53 activation and DNA damage response during cisplatin-induced apoptosis.
18086786 2007 Activated checkpoint kinase 2 expression and risk for oral squamous cell carcinoma.
18086781 2007 Inherited predisposition of lung cancer: a hierarchical modeling approach to DNA repair and cell cycle control pathways.
18085035 2007 Germline CHEK2 mutations in Jewish Ashkenazi women at high risk for breast cancer.
18058223 2008 Analysis of CHEK2 FHA domain in Czech patients with sporadic breast cancer revealed distinct rare genetic alterations.
18024013 2008 Common variants of DNA repair genes and malignant melanoma.
18004398 2007 CHK2 kinase: cancer susceptibility and cancer therapy - two sides of the same coin?
17918154 2008 Germline mutations in the CHEK2 kinase gene are associated with an increased risk of bladder cancer.
17876702 2008 Absence of CHEK2 1100delC mutation in familial breast cancer cases from a South American population.
17721994 2007 Genetic and functional analysis of CHEK2 (CHK2) variants in multiethnic cohorts.
17715138 2007 Stability of checkpoint kinase 2 is regulated via phosphorylation at serine 456.
17705858 2007 CHEK2 1100delC is prevalent in Swedish early onset familial breast cancer.
17698850 2007 Human T-cell leukemia virus type 1 Tax oncoprotein prevents DNA damage-induced chromatin egress of hyperphosphorylated Chk2.
17694537 2008 Does the nonsense-mediated mRNA decay mechanism prevent the synthesis of truncated BRCA1, CHK2, and p53 proteins?
17684142 2007 Polymorphisms in apoptosis and cell cycle control genes and risk of brain tumors in adults.
17671118 2007 The role of the DNA damage checkpoint pathway in intraductal papillary mucinous neoplasms of the pancreas.
17663721 2007 Chk2 kinase is required for methylglyoxal-induced G2/M cell-cycle checkpoint arrest: implication of cell-cycle checkpoint regulation in diabetic oxidative stress signaling.
17661168 2008 BRCA1/BRCA2 rearrangements and CHEK2 common mutations are infrequent in Italian male breast cancer cases.
17634426 2007 Endogenous gamma-H2AX-ATM-Chk2 checkpoint activation in Bloom's syndrome helicase deficient cells is related to DNA replication arrested forks.
17544403 2007 Reoxygenation following hypoxia activates DNA-damage checkpoint signaling pathways that suppress cell-cycle progression in cultured human lymphocytes.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17517688 2007 Uncommon CHEK2 mis-sense variant and reduced risk of tobacco-related cancers: case control study.
17464182 2007 Identification of novel substrates for human checkpoint kinase Chk1 and Chk2 through genome-wide screening using a consensus Chk phosphorylation motif.
17428325 2007 Common variants in the ATM, BRCA1, BRCA2, CHEK2 and TP53 cancer susceptibility genes are unlikely to increase breast cancer risk.
17428320 2007 Identification of women with an increased risk of developing radiation-induced breast cancer: a case only study.
17409195 2007 This article was published online in error and has been removed by the publisher.
17409144 2007 The ATM/ATR signaling effector Chk2 is targeted by Epstein-Barr virus nuclear antigen 3C to release the G2/M cell cycle block.
17380889 [Analysis of BRCA1/2 and CHEK2 mutations in ovarian cancer and primary multiple tumors involving the ovaries. Patients of Russian population using biochips].
17380128 2007 Phosphorylation of pRB at Ser612 by Chk1/2 leads to a complex between pRB and E2F-1 after DNA damage.
17372254 2007 Epistatic relationship between the cancer susceptibility genes CHEK2 and p27.
17341484 2007 Counting potentially functional variants in BRCA1, BRCA2 and ATM predicts breast cancer susceptibility.
17333477 2007 Founder mutations in early-onset, familial and bilateral breast cancer patients from Russia.
17333333 2008 BARD1 and breast cancer in Poland.
17317627 2007 Phosphorylation of HuR by Chk2 regulates SIRT1 expression.
17250914 2007 Breast cancer in patients carrying a germ-line CHEK2 mutation: Outcome after breast conserving surgery and adjuvant radiotherapy.
17214356 The CHEK2 1100delC variant in Swedish colorectal cancer.
17178848 2006 Activated checkpoint kinase 2 provides a survival signal for tumor cells.
17169815 2006 CHEK2*1100delC and risk of chronic lymphocytic leukemia.
17164383 2006 A multicenter study of cancer incidence in CHEK2 1100delC mutation carriers.
17164260 2007 Effect of ATM, CHEK2 and ERBB2 TAGSNPs and haplotypes on endometrial cancer risk.
17157788 2006 Che-1 phosphorylation by ATM/ATR and Chk2 kinases activates p53 transcription and the G2/M checkpoint.
17145815 2006 Genetic and epigenetic analysis of CHEK2 in sporadic breast, colon, and ovarian cancers.
17132695 2007 Breast cancer survival and tumor characteristics in premenopausal women carrying the CHEK2*1100delC germline mutation.
17132159 2006 Comprehensive analysis of the ATM, CHEK2 and ERBB2 genes in relation to breast tumour characteristics and survival: a population-based case-control and follow-up study.
17113724 2006 Large genomic BRCA2 rearrangements and male breast cancer.
17106448 2007 Germline CHEK2 mutations and colorectal cancer risk: different effects of a missense and truncating mutations?
17101782 2007 Chk2 mediates stabilization of the FoxM1 transcription factor to stimulate expression of DNA repair genes.
17085682 2006 A large germline deletion in the Chek2 kinase gene is associated with an increased risk of prostate cancer.
17040931 2007 The association of sequence variants in DNA repair and cell cycle genes with cancers of the upper aerodigestive tract.
17030982 2006 Promyelocytic leukemia nuclear bodies behave as DNA damage sensors whose response to DNA double-strand breaks is regulated by NBS1 and the kinases ATM, Chk2, and ATR.
17026620 2006 Inherited association of breast and colorectal cancer: limited role of CHEK2 compared with high-penetrance genes.
17010071 2006 Association between the CHEK2*1100delC germ line mutation and estrogen receptor status.
16998506 2006 The CHEK2 gene and inherited breast cancer susceptibility.
16998498 2006 Pathology and gene expression of hereditary breast tumors associated with BRCA1, BRCA2 and CHEK2 gene mutations.
16943424 2006 Differential roles of ATM- and Chk2-mediated phosphorylations of Hdmx in response to DNA damage.
16941491 2006 Unique substitution of CHEK2 and TP53 mutations implicated in primary prostate tumors and cancer cell lines.
16940182 2006 DNA damage-induced cell cycle regulation and function of novel Chk2 phosphoresidues.
16936775 2007 The Wip1 phosphatase (PPM1D) antagonizes activation of the Chk2 tumour suppressor kinase.
16914568 2006 CHEK2-positive breast cancers in young Polish women.
16905549 2006 Defective Mre11-dependent activation of Chk2 by ataxia telangiectasia mutated in colorectal carcinoma cells in response to replication-dependent DNA double strand breaks.
16883537 2006 [CHEK2 c.1100delC may not contribute to genetic background of hereditary breast cancer from Shanghai of China].
16880452 2007 Increased risk of breast cancer associated with CHEK2*1100delC.
16858628 2006 Low frequency of CHEK2 mutations in familial pancreatic cancer.
16835864 2006 Characterization of CHEK2 mutations in prostate cancer.
16835227 2006 Promyelocytic leukemia activates Chk2 by mediating Chk2 autophosphorylation.
16830057 2006 Low frequency of the CHEK2*1100delC mutation among breast cancer probands from three regions of Poland.
16828850 2006 CHEK2 variants predispose to benign, borderline and low-grade invasive ovarian tumors.
16816021 2006 CHEK2 I157T associates with familial and sporadic colorectal cancer.
16798742 2006 Intrinsic kinase activity and SQ/TQ domain of Chk2 kinase as well as N-terminal domain of Wip1 phosphatase are required for regulation of Chk2 by Wip1.
16794575 2006 Trans-activation of the DNA-damage signalling protein kinase Chk2 by T-loop exchange.
16790090 2006 Fusion of the tumor-suppressor gene CHEK2 and the gene for the regulatory subunit B of protein phosphatase 2 PPP2R2A in childhood teratoma.
16758118 2006 CHEK2 1100delC mutation is frequent among Russian breast cancer patients.
16741947 2006 ATR dependent activation of Chk2.
16732333 2006 Depletion of CHK1, but not CHK2, induces chromosomal instability and breaks at common fragile sites.
16705183 2006 p14ARF activates a Tip60-dependent and p53-independent ATM/ATR/CHK pathway in response to genotoxic stress.
16671833 2006 Linkage disequilibrium mapping of CHEK2: common variation and breast cancer risk.
16596250 2006 Protein phosphatase 2A interacts with Chk2 and regulates phosphorylation at Thr-68 after cisplatin treatment of human ovarian cancer cells.
16574953 2006 Variants in the ATM-BRCA2-CHEK2 axis predispose to chronic lymphocytic leukemia.
16539695 2006 CHEK2 1100delC in patients with metachronous cancers of the breast and the colorectum.
16492927 2006 The CHEK2*1100delC allelic variant and risk of breast cancer: screening results from the Breast Cancer Family Registry.
16481012 2006 Priming phosphorylation of Chk2 by polo-like kinase 3 (Plk3) mediates its full activation by ATM and a downstream checkpoint in response to DNA damage.
16452051 2006 CHEK2*1100delC is not an important high-risk gene in families with hereditary prostate cancer in southern Sweden.
16437383 2006 Expression of checkpoint kinase 2 in breast carcinomas: correlation with key regulators of tumor cell proliferation, angiogenesis, and survival.
16414312 2006 Targeted gene repair activates Chk1 and Chk2 and stalls replication in corrected cells.
16341674 2005 Transcriptome analysis of human gastric cancer.
16337852 2005 Chromosomal radiosensitivity of breast cancer with a CHEK2 mutation.
16317088 2005 p53-independent regulation of p21Waf1/Cip1 expression and senescence by Chk2.
16311512 2006 Regulation of the antioncogenic Chk2 kinase by the oncogenic Wip1 phosphatase.
16257342 2005 Interaction between CHEK2*1100delC and other low-penetrance breast-cancer susceptibility genes: a familial study.
16239104 2005 German populations with infrequent CHEK2*1100delC and minor associations with early-onset and familial breast cancer.
16163388 2005 ATM and Chk2-dependent phosphorylation of MDMX contribute to p53 activation after DNA damage.
16078115 2005 CHEK2 mutations in primary glioblastomas.
16043347 2005 No increased susceptibility to breast cancer from combined CHEK2 1100delC genotype and the HLA class III region risk factors.
15987456 2005 TP53-binding protein variants and breast cancer risk: a case-control study.
15980987 2005 Breast cancer predisposing alleles in Poland.
15964795 2005 Mutations in proline 82 of p53 impair its activation by Pin1 and Chk2 in response to DNA damage.
15942682 2005 Aberrations of the CHK2 gene are rare in pediatric solid tumors.
15876876 2005 The Plk1 Polo box domain mediates a cell cycle and DNA damage regulated interaction with Chk2.
15862297 2005 HDM2 negatively affects the Chk2-mediated phosphorylation of p53.
15852425 2005 Colorectal cancer and the CHEK2 1100delC mutation.
15818573 2005 Homozygosity for a CHEK2*1100delC mutation identified in familial colorectal cancer does not lead to a severe clinical phenotype.
15810020 2005 Association of two mutations in the CHEK2 gene with breast cancer.
15803365 2005 Pathology of breast cancer in women with constitutional CHEK2 mutations.
15803363 2005 The CHEK2 c.1100delC germline mutation rarely contributes to breast cancer development in the Czech Republic.
15700044 2005 Low frequency of CHEK2 1100delC allele in Australian multiple-case breast cancer families: functional analysis in heterozygous individuals.
15694385 2005 Inducible degradation of checkpoint kinase 2 links to cisplatin-induced resistance in ovarian cancer cells.
15668230 2005 Regulation of CHK2 by DNA-dependent protein kinase.
15659650 2005 p53 C-terminal phosphorylation by CHK1 and CHK2 participates in the regulation of DNA-damage-induced C-terminal acetylation.
15649950 2005 Functional and genomic approaches reveal an ancient CHEK2 allele associated with breast cancer in the Ashkenazi Jewish population.
15647386 2005 Methylator-induced, mismatch repair-dependent G2 arrest is activated through Chk1 and Chk2.
15618221 2005 TTK/hMps1 participates in the regulation of DNA damage checkpoint response by phosphorylating CHK2 on threonine 68.
15601819 2004 p73 induction after DNA damage is regulated by checkpoint kinases Chk1 and Chk2.
15535844 2004 Frequency of CHEK2 mutations in a population based, case-control study of breast cancer in young women.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15492928 2004 CHEK2 is a multiorgan cancer susceptibility gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488637 2004 Analysis of familial male breast cancer for germline mutations in CHEK2.
15472904 2005 Correlation of CHEK2 protein expression and c.1100delC mutation status with tumor characteristics among unselected breast cancer patients.
15467464 2004 Evolutionary conservation of a novel splice variant of the Cds1/CHK2 checkpoint kinase restricted to its regulatory domain.
15466005 2004 Tumour characteristics and prognosis of breast cancer patients carrying the germline CHEK2*1100delC variant.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15385111 2004 Analysis of CHEK2 gene for ovarian cancer susceptibility.
15380617 2004 Regulation of Chk2 phosphorylation by interaction with protein phosphatase 2A via its B' regulatory subunit.
15361853 2004 Alternative splicing and mutation status of CHEK2 in stage III breast cancer.
15361851 2004 Aberrations of the Chk2 tumour suppressor in advanced urinary bladder cancer.
15361830 2004 Activation of ATM and Chk2 kinases in relation to the amount of DNA strand breaks.
15342622 2004 The stress kinase MRK contributes to regulation of DNA damage checkpoints through a p38gamma-independent pathway.
15279791 The Chk2 protein kinase.
15239132 2004 CHEK2 variant I157T may be associated with increased breast cancer risk.
15192702 2004 DNA damage checkpoint kinase Chk2 triggers replicative senescence.
15149599 2004 Telomere shortening triggers senescence of human cells through a pathway involving ATM, p53, and p21(CIP1), but not p16(INK4a).
15095295 2004 Limited relevance of the CHEK2 gene in hereditary breast cancer.
15087378 2004 A novel founder CHEK2 mutation is associated with increased prostate cancer risk.
15057041 2004 Rarity of germline 1100delC mutation in CHK2 in patients with malignant melanoma of the skin.
15048074 2004 The cell cycle checkpoint kinase Chk2 is a negative regulator of mitotic catastrophe.
15044452 2004 Negative regulation of Chk2 expression by p53 is dependent on the CCAAT-binding transcription factor NF-Y.
15024084 2004 Apoptosis associated with deregulated E2F activity is dependent on E2F1 and Atm/Nbs1/Chk2.
14997059 2004 Excess risk for contralateral breast cancer in CHEK2*1100delC germline mutation carriers.
14970869 2004 The CHEK2(*)1100delC mutation has no major contribution in oesophageal carcinogenesis.
14744935 2004 Endoplasmic reticulum stress induces p53 cytoplasmic localization and prevents p53-dependent apoptosis by a pathway involving glycogen synthase kinase-3beta.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701743 2004 Chk2 phosphorylation of BRCA1 regulates DNA double-strand break repair.
14681223 2004 Differential mode of regulation of the checkpoint kinases CHK1 and CHK2 by their regulatory domains.
14678969 2003 The CHEK2*1100delC variant acts as a breast cancer risk modifier in non-BRCA1/BRCA2 multiple-case families.
14648717 2004 CHEK2 1100delC is not a risk factor for male breast cancer population.
14624239 2003 Biochemical characterization of DNA damage checkpoint complexes: clamp loader and clamp complexes with specificity for 5' recessed DNA.
14612911 2003 CHEK2 variants associate with hereditary prostate cancer.
14568168 2003 Contribution of the CHEK2 1100delC variant to risk of multiple colorectal adenoma and carcinoma.
14514889 2003 Zinc-finger protein-targeted gene regulation: genomewide single-gene specificity.
14507240 BRCA1, BRCA2 and CHEK2 (1100 del C) germline mutations in hereditary breast and ovarian cancer families in South India.
12917215 2003 Common polymorphisms in checkpoint kinase 2 are not associated with breast cancer risk.
12909615 2003 Karyopherin-alpha2 protein interacts with Chk2 and contributes to its nuclear import.
12897801 2003 Allosteric effects mediate CHK2 phosphorylation of the p53 transactivation domain.
12855706 2003 Autophosphorylation of checkpoint kinase 2 at serine 516 is required for radiation-induced apoptosis.
12810724 2003 The promyelocytic leukemia protein protects p53 from Mdm2-mediated inhibition and degradation.
12805407 2003 Regulation of the Chk2 protein kinase by oligomerization-mediated cis- and trans-phosphorylation.
12717439 2003 Chk2 activates E2F-1 in response to DNA damage.
12711320 2003 Determination of substrate specificity and putative substrates of Chk2 kinase.
12690581 2003 The CHEK2 1100delC mutation identifies families with a hereditary breast and colorectal cancer phenotype.
12676583 2003 Chk1 regulates the S phase checkpoint by coupling the physiological turnover and ionizing radiation-induced accelerated proteolysis of Cdc25A.
12654917 2003 The Chk2 tumor suppressor is not required for p53 responses in human cancer cells.
12654916 2003 Questioning the role of checkpoint kinase 2 in the p53 DNA damage response.
12610780 2003 Variants in CHEK2 other than 1100delC do not make a major contribution to breast cancer susceptibility.
12607004 2003 MDC1 is coupled to activated CHK2 in mammalian DNA damage response pathways.
12556502 2003 Direct kinase-to-kinase signaling mediated by the FHA phosphoprotein recognition domain of the Dun1 DNA damage checkpoint kinase.
12551934 2003 NFBD1, like 53BP1, is an early and redundant transducer mediating Chk2 phosphorylation in response to DNA damage.
12548019 Genotoxic stress-induced activation of Plk3 is partly mediated by Chk2.
12533788 2003 Mutations in CHEK2 associated with prostate cancer risk.
12529183 2003 Frequency of CHEK2*1100delC in New York breast cancer cases and controls.
12493754 2003 Polo-like kinase 1 and Chk2 interact and co-localize to centrosomes and the midbody.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12454775 2002 CHEK2 variants in susceptibility to breast cancer and evidence of retention of the wild type allele in tumours.
12447371 2003 The mismatch repair system is required for S-phase checkpoint activation.
12441400 2002 An N-terminal domain of Dbf4p mediates interaction with both origin recognition complex (ORC) and Rad53p and can deregulate late origin firing.
12402044 2002 PML-dependent apoptosis after DNA damage is regulated by the checkpoint kinase hCds1/Chk2.
12393693 2002 CHK2-decreased protein expression and infrequent genetic alterations mainly occur in aggressive types of non-Hodgkin lymphomas.
12386164 2002 Checkpoint kinase 2 (Chk2) monomers or dimers phosphorylate Cdc25C after DNA damage regardless of threonine 68 phosphorylation.
12364621 2002 53BP1, a mediator of the DNA damage checkpoint.
12242661 2002 Mammalian Polo-like kinase 3 (Plk3) is a multifunctional protein involved in stress response pathways.
12111733 2002 Checking in on Cds1 (Chk2): A checkpoint kinase and tumor suppressor.
12094328 2002 A CHEK2 genetic variant contributing to a substantial fraction of familial breast cancer.
12052256 2002 Mutation analysis of the CHK2 gene in breast carcinoma and other cancers.
12049741 2002 Rad9 phosphorylation sites couple Rad53 to the Saccharomyces cerevisiae DNA damage checkpoint.
12049740 2002 Structural and functional versatility of the FHA domain in DNA-damage signaling by the tumor suppressor kinase Chk2.
12024051 2002 Chk2 activation and phosphorylation-dependent oligomerization.
11967536 2002 Low-penetrance susceptibility to breast cancer due to CHEK2(*)1100delC in noncarriers of BRCA1 or BRCA2 mutations.
11901158 2002 Phosphorylation of threonine 68 promotes oligomerization and autophosphorylation of the Chk2 protein kinase via the forkhead-associated domain.
11875739 2002 Analysis of CHK2 in vulval neoplasia.
11821419 2002 Determination of substrate motifs for human Chk1 and hCds1/Chk2 by the oriented peptide library approach.
11751432 2001 Polymorphic hCHK2/hCds1 codon 84 allele and risk of squamous cell carcinoma of the head and neck--a case-control analysis.
11746983 2002 Mutations of the CHK2 gene are found in some osteosarcomas, but are rare in breast, lung, and ovarian tumors.
11741546 2001 Human Mus81-associated endonuclease cleaves Holliday junctions in vitro.
11719428 2001 Destabilization of CHK2 by a missense mutation associated with Li-Fraumeni Syndrome.
11715017 2001 Mrc1 channels the DNA replication arrest signal to checkpoint kinase Cds1.
11551930 2001 Plk3 functionally links DNA damage to cell cycle arrest and apoptosis at least in part via the p53 pathway.
11461078 2001 Mutation analysis of the CHK2 gene in families with hereditary breast cancer.
11438675 2001 Chk2 activation dependence on Nbs1 after DNA damage.
11390408 2001 The hCds1 (Chk2)-FHA domain is essential for a chain of phosphorylation events on hCds1 that is induced by ionizing radiation.
11333986 2001 Initiation of a G2/M checkpoint after ultraviolet radiation requires p38 kinase.
11298456 2001 The ATM-Chk2-Cdc25A checkpoint pathway guards against radioresistant DNA synthesis.
11172707 2001 Dynamic interaction of DNA damage checkpoint protein Rad53 with chromatin assembly factor Asf1.
11073977 2000 Damage tolerance protein Mus81 associates with the FHA1 domain of checkpoint kinase Cds1.
10973490 2000 Ataxia telangiectasia-mutated phosphorylates Chk2 in vivo and in vitro.
10801407 2000 How to activate p53.
10744722 2000 Caffeine abolishes the mammalian G(2)/M DNA damage checkpoint by inhibiting ataxia-telangiectasia-mutated kinase activity.
10724175 2000 hCds1-mediated phosphorylation of BRCA1 regulates the DNA damage response.
10710310 2000 DNA damage-induced activation of p53 by the checkpoint kinase Chk2.
10673500 2000 Chk2/hCds1 functions as a DNA damage checkpoint in G(1) by stabilizing p53.
10617473 1999 Heterozygous germ line hCHK2 mutations in Li-Fraumeni syndrome.
10591208 1999 The DNA sequence of human chromosome 22.
10557092 1999 The physical association and phosphorylation of Cdc25C protein phosphatase by Prk.
10435585 1999 Mammalian Chk2 is a downstream effector of the ATM-dependent DNA damage checkpoint pathway.
10097108 1999 A human Cds1-related kinase that functions downstream of ATM protein in the cellular response to DNA damage.
9889122 1999 A human homologue of the checkpoint kinase Cds1 directly inhibits Cdc25 phosphatase.
9857181 1998 Analysis of Rad3 and Chk1 protein kinases defines different checkpoint responses.
9836640 1998 Linkage of ATM to cell cycle regulation by the Chk2 protein kinase.
9450932 1998 S-phase-specific activation of Cds1 kinase defines a subpathway of the checkpoint response in Schizosaccharomyces pombe.
9407135 1997 The role of CDP-diacylglycerol synthetase and phosphatidylinositol synthase activity levels in the regulation of cellular phosphatidylinositol content.
9278512 1997 Mitotic and G2 checkpoint control: regulation of 14-3-3 protein binding by phosphorylation of Cdc25C on serine-216.