Property Summary

Ligand Count 53
NCBI Gene PubMed Count 474
PubMed Score 978.74
PubTator Score 885.31

Knowledge Summary

Patent (45,013)

TINX Plot

  Disease (10)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
DOID:2627 94 0.0 1.2
Kidney cancer 2613 0.0 1.0
Disease Target Count Z-score Confidence
Gastrointestinal system cancer 3 0.0 3.0
Glaucoma 239 0.0 3.0
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 1.2
ovarian cancer 8520 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 5.899 2.9
Disease Target Count Z-score Confidence
Ataxia telangiectasia 34 4.819 2.4
Nijmegen breakage syndrome 24 4.446 2.2

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.124 2.2e-03
atypical teratoid / rhabdoid tumor 1.400 8.1e-07
glioblastoma 1.300 6.3e-07
group 3 medulloblastoma 1.500 9.3e-04
lung cancer 2.000 3.3e-04
malignant mesothelioma 1.200 1.5e-05
medulloblastoma, large-cell 2.100 2.1e-06
non-small cell lung cancer 1.441 1.6e-16
pediatric high grade glioma 1.100 1.4e-05
primitive neuroectodermal tumor 1.100 1.3e-03
tuberculosis 1.400 4.7e-06

Synonym

Accession O96017 A8K3Y9 B7ZBF3 B7ZBF4 B7ZBF5 Q6QA03 Q6QA04 Q6QA05 Q6QA06 Q6QA07 Q6QA08 Q6QA10 Q6QA11 Q6QA12 Q6QA13 Q9HBS5 Q9HCQ8 Q9UGF0 Q9UGF1
Symbols CDS1
CHK2
LFS2
RAD53
hCds1
HuCds1
PP1425

Gene

PDB (38)

Gene RIF (487)

AA Sequence

MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQE      1 - 70
LYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYS     71 - 140
KKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQS    141 - 210
VYPKALRDEYIMSKTLGSGACGEVKLAFERKTCKKVAIKIISKRKFAIGSAREADPALNVETEIEILKKL    211 - 280
NHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKP    281 - 350
ENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFIC    351 - 420
LSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDED    421 - 490
MKRKFQDLLSEENESTALPQVLAQPSTSRKRPREGEAEGAETTKRPAVCAAVL                     491 - 543
//

Text Mined References (483)

PMID Year Title