Property Summary

NCBI Gene PubMed Count 37
PubMed Score 133.85
PubTator Score 61.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
interstitial lung disease -1.200 2.7e-02
malignant mesothelioma 1.400 1.8e-06
glioblastoma 1.300 3.6e-03
group 3 medulloblastoma 1.400 2.6e-02
medulloblastoma, large-cell 1.100 3.0e-03
primitive neuroectodermal tumor 1.600 4.3e-05
Crohn's disease -1.236 3.3e-03
ulcerative colitis -1.629 8.4e-04
adrenocortical carcinoma -1.185 9.6e-04
lung cancer -1.100 3.1e-03
diabetes mellitus -1.300 1.8e-02
pediatric high grade glioma 1.100 1.2e-03
ovarian cancer 1.300 4.3e-04

 GO Component (2)

Pathway (1)

Gene RIF (22)

PMID Text
26792750 These results indicate that CHD1 is a positive regulator of influenza virus multiplication and suggest a role for chromatin remodeling in the control of the influenza virus life cycle.
26751641 These data link the assembly of methylated KDM1A and CHD1 with AR-dependent transcription and genomic translocations, thereby providing mechanistic insight into the formation of TMPRSS2-ERG gene fusions during prostate-tumor evolution.
25879624 We have identified CHD1 as the RUNX1 fusion partner in acute myeloid leukemia with t(5;21)(q21;q22).
25770290 identify coordinate loss of MAP3K7 and CHD1 as a unique driver of aggressive prostate cancer development
25297984 CHD1 and CHD2 act as positive regulators of HIV-1 gene expression.
25175909 results demonstrate the ability of confocal microscopy and FISH to identify the cell-to-cell differences in common gene fusions such as TMPRSS2-ERG that may arise independently within the same tumor focus
24853335 The double chromodomains of CHD1 adopt an 'open pocket' to interact with the free N-terminal amine of H3K4, and the open pocket permits the NS1 mimic to bind in a distinct conformation.
24735615 Data indicate that chromodomain-helicase-DNA-binding protein CHD1, neoplasm protein GREB1 and karyopherin alpha 2 protein KPNA2 as critical mediators of miR-26a and miR-26b elicited cell growth.
23492366 CHD1 is the 5q21 tumor suppressor gene in prostate cancer
22179824 findings suggest that CHD1 deletion may underlie cell invasiveness in a subset of prostate cancers, and indicate a possible novel role of altered chromatin remodeling in prostate tumorigenesis
22139082 findings collectively suggest that distinct CHD1-associated alterations of genomic structure evolve during and are required for the development of prostate cancer
22048254 CHD1, was the most "dietary sensitive" genes, as methylation of their promoters was associated with intakes of at least two out of the eight dietary methyl factors examined.
22046413 that hPaf1/PD2 in association with MLL1 regulates methylation of H3K4 residues, as well as interacts and regulates nuclear shuttling of chromatin remodeling protein CHD1, facilitating its function in pancreatic cancer cells
21979373 Mediator coactivator complex, which controls PIC assembly, is also necessary for CHD1 recruitment
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20363151 Observational study of genotype prevalence. (HuGE Navigator)
19625449 CENP-H-containing complex facilitates deposition of newly synthesized CENP-A into centromeric chromatin in cooperation with FACT and CHD1.
19441106 overexpression of CHD1L could sustain tumor cell survival by preventing Nur77-mediated apoptosis
17098252 analysis of chromodomains in human and fungal Chd1
16372014 the structure of the tandem arrangement of the human CHD1 chromodomains, and its interactions with histone tails
16263726 yeast and human CHD1 have diverged in their ability to discriminate covalently modified histones and link histone modification-recognition and non-covalent chromatin remodeling activities within a single human protein
12890497 associates with NCoR and histone deacetylase as well as with RNA splicing proteins

AA Sequence

MNGHSDEESVRNSSGESSQSDDDSGSASGSGSGSSSGSSSDGSSSQSGSSDSDSGSESGSQSESESDTSR      1 - 70
ENKVQAKPPKVDGAEFWKSSPSILAVQRSAILKKQQQQQQQQQHQASSNSGSEEDSSSSEDSDDSSSEVK     71 - 140
RKKHKDEDWQMSGSGSPSQSGSDSESEEEREKSSCDETESDYEPKNKVKSRKPQNRSKSKNGKKILGQKK    141 - 210
RQIDSSEEDDDEEDYDNDKRSSRRQATVNVSYKEDEEMKTDSDDLLEVCGEDVPQPEEEEFETIERFMDC    211 - 280
RIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLD    281 - 350
NYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSE    351 - 420
CSWEDGALISKKFQACIDEYFSRNQSKTTPFKDCKVLKQRPRFVALKKQPSYIGGHEGLELRDYQLNGLN    421 - 490
WLAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREIQTWASQMNAVV    491 - 560
YLGDINSRNMIRTHEWTHHQTKRLKFNILLTTYEILLKDKAFLGGLNWAFIGVDEAHRLKNDDSLLYKTL    561 - 630
IDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFSSWEDFEEEHGKGREYGYASLHKELEPFLLRRVKK    631 - 700
DVEKSLPAKVEQILRMEMSALQKQYYKWILTRNYKALSKGSKGSTSGFLNIMMELKKCCNHCYLIKPPDN    701 - 770
NEFYNKQEALQHLIRSSGKLILLDKLLIRLRERGNRVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSIKG    771 - 840
ELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIY    841 - 910
RLVTKGSVEEDILERAKKKMVLDHLVIQRMDTTGKTVLHTGSAPSSSTPFNKEELSAILKFGAEELFKEP    911 - 980
EGEEQEPQEMDIDEILKRAETHENEPGPLTVGDELLSQFKVANFSNMDEDDIELEPERNSKNWEEIIPED    981 - 1050
QRRRLEEEERQKELEEIYMLPRMRNCAKQISFNGSEGRRSRSRRYSGSDSDSISEGKRPKKRGRPRTIPR   1051 - 1120
ENIKGFSDAEIRRFIKSYKKFGGPLERLDAIARDAELVDKSETDLRRLGELVHNGCIKALKDSSSGTERT   1121 - 1190
GGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSN   1191 - 1260
LLIGIYEYGYGSWEMIKMDPDLSLTHKILPDDPDKKPQAKQLQTRADYLIKLLSRDLAKKEALSGAGSSK   1261 - 1330
RRKARAKKNKAMKSIKVKEEIKSDSSPLPSEKSDEDDDKLSESKSDGRERSKKSSVSDAPVHITASGEPV   1331 - 1400
PISEESEELDQKTFSICKERMRPVKAALKQLDRPEKGLSEREQLEHTRQCLIKIGDHITECLKEYTNPEQ   1401 - 1470
IKQWRKNLWIFVSKFTEFDARKLHKLYKHAIKKRQESQQNSDQNSNLNPHVIRNPDVERLKENTNHDDSS   1471 - 1540
RDSYSSDRHLTQYHDHHKDRHQGDSYKKSDSRKRPYSSFSNGKDHRDWDHYKQDSRYYSDREKHRKLDDH   1541 - 1610
RSRDHRSNLEGSLKDRSHSDHRSHSDHRLHSDHRSSSEYTHHKSSRDYRYHSDWQMDHRASSSGPRSPLD   1611 - 1680
QRSPYGSRSPFEHSVEHKSTPEHTWSSRKT                                           1681 - 1710
//

Text Mined References (50)

PMID Year Title
27591891 2016 The Chromatin Remodelling Protein CHD1 Contains a Previously Unrecognised C-Terminal Helical Domain.
26792750 2016 Influenza Virus and Chromatin: Role of the CHD1 Chromatin Remodeler in the Virus Life Cycle.
26751641 2016 Assembly of methylated KDM1A and CHD1 drives androgen receptor-dependent transcription and translocation.
25879624 2015 Transcriptome sequencing reveals CHD1 as a novel fusion partner of RUNX1 in acute myeloid leukemia with t(5;21)(q21;q22).
25770290 2015 Coordinate loss of MAP3K7 and CHD1 promotes aggressive prostate cancer.
25297984 2014 CHD1 and CHD2 are positive regulators of HIV-1 gene expression.
25175909 2014 ERG and CHD1 heterogeneity in prostate cancer: use of confocal microscopy in assessment of microscopic foci.
24853335 2014 Structural basis for histone mimicry and hijacking of host proteins by influenza virus protein NS1.
24735615 2014 Identification of miR-26 as a key mediator of estrogen stimulated cell proliferation by targeting CHD1, GREB1 and KPNA2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23492366 2013 CHD1 is a 5q21 tumor suppressor required for ERG rearrangement in prostate cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22419161 2012 Suppression of the antiviral response by an influenza histone mimic.
22179824 2012 Recurrent deletion of CHD1 in prostate cancer with relevance to cell invasiveness.
22139082 2012 Identification of novel CHD1-associated collaborative alterations of genomic structure and functional assessment of CHD1 in prostate cancer.
22048254 2011 The influence of one-carbon metabolism on gene promoter methylation in a population-based breast cancer study.
22046413 2011 Human RNA polymerase II-association factor 1 (hPaf1/PD2) regulates histone methylation and chromatin remodeling in pancreatic cancer.
22044751 2011 Heritability and genome-wide association analysis of renal sinus fat accumulation in the Framingham Heart Study.
21979373 2011 Mediator coordinates PIC assembly with recruitment of CHD1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21029866 2010 Nucleosome-interacting proteins regulated by DNA and histone methylation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20363151 2010 Interleukin 10 polymorphisms differentially influence the risk of gastric cancer in East Asians and Caucasians.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19625449 2009 CENP-H-containing complex facilitates centromere deposition of CENP-A in cooperation with FACT and CHD1.
19441106 2009 Chromodomain helicase/adenosine triphosphatase DNA binding protein 1-like (CHD1l) gene suppresses the nucleus-to-mitochondria translocation of nur77 to sustain hepatocellular carcinoma cell survival.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18042460 2007 Recognition of trimethylated histone H3 lysine 4 facilitates the recruitment of transcription postinitiation factors and pre-mRNA splicing.
17433364 2007 Molecular implications of evolutionary differences in CHD double chromodomains.
17098252 2007 Structural polymorphism of chromodomains in Chd1.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16372014 2005 Double chromodomains cooperate to recognize the methylated histone H3 tail.
16263726 2005 Human but not yeast CHD1 binds directly and selectively to histone H3 methylated at lysine 4 via its tandem chromodomains.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12890497 2003 CHD1 associates with NCoR and histone deacetylase as well as with RNA splicing proteins.
12522270 2003 Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10199952 1999 CHD1 interacts with SSRP1 and depends on both its chromodomain and its ATPase/helicase-like domain for proper association with chromatin.
9326634 1997 Characterization of the CHD family of proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8460153 1993 A mammalian DNA-binding protein that contains a chromodomain and an SNF2/SWI2-like helicase domain.
7739555 1995 DNA-binding and chromatin localization properties of CHD1.