Property Summary

NCBI Gene PubMed Count 23
PubMed Score 70.61
PubTator Score 49.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
astrocytic glioma 2530 2.9e-02
ependymoma 4559 3.6e-02

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytic glioma -1.100 2.9e-02
ependymoma -1.100 3.6e-02

Gene RIF (17)

AA Sequence

MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKS      1 - 70
AFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEG     71 - 140
SS                                                                        141 - 142
//

Text Mined References (27)

PMID Year Title