Property Summary

Ligand Count 7
NCBI Gene PubMed Count 95
PubMed Score 2597.23
PubTator Score 193.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
psoriasis 6694 7.3e-17
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Congenital myasthenic syndrome 25 0.0 4.0
Disease Target Count
Familial infantile myasthenia 1

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.900 7.3e-17

Gene RIF (82)

AA Sequence

MGLRTAKKRGLGGGGKWKREEGGGTRGRREVRPACFLQSGGRGDPGDVGGPAGNPGCSPHPRAATRPPPL      1 - 70
PAHTPAHTPEWCGAASAEAAEPRRAGPHLCIPAPGLTKTPILEKVPRKMAAKTPSSEESGLPKLPVPPLQ     71 - 140
QTLATYLQCMRHLVSEEQFRKSQAIVQQFGAPGGLGETLQQKLLERQEKTANWVSEYWLNDMYLNNRLAL    141 - 210
PVNSSPAVIFARQHFPGTDDQLRFAASLISGVLSYKALLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSY    211 - 280
RLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPI    281 - 350
GLLTSDGRSEWAEARTVLVKDSTNRDSLDMIERCICLVCLDAPGGVELSDTHRALQLLHGGGYSKNGANR    351 - 420
WYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHVTQSSRKLIRADSVSELPAPRRLRWKCSPE    421 - 490
IQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVPTYESASIR    491 - 560
RFQEGRVDNIRSATPEALAFVRAVTDHKAAVPASEKLLLLKDAIRAQTAYTVMAITGMAIDNHLLALREL    561 - 630
ARAMCKELPEMFMDETYLMSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCK    631 - 700
ETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPSQGHQP                          701 - 748
//

Text Mined References (97)

PMID Year Title