Property Summary

NCBI Gene PubMed Count 25
PubMed Score 10.41
PubTator Score 13.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 4.0e-07
Breast cancer 3.600 2.5e-02
glioblastoma 1.600 1.4e-05
group 4 medulloblastoma 1.600 2.7e-04
medulloblastoma, large-cell 1.800 1.5e-06
osteosarcoma 1.130 1.1e-04
ovarian cancer -1.700 9.6e-06
primary pancreatic ductal adenocarcinoma 1.094 3.4e-03
spina bifida -1.223 3.8e-02

Gene RIF (10)

AA Sequence

MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKR      1 - 70
KAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSI     71 - 140
PKSDQLRRAYLPDGYENENQLLNSQDC                                               141 - 167
//

Text Mined References (29)

PMID Year Title