Property Summary

Ligand Count 600
NCBI Gene PubMed Count 39
PubMed Score 244.56
PubTator Score 239.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Obesity 678 4.511 2.3
diabetes mellitus 1728 3.156 1.6

Expression

  Differential Expression (23)

Disease log2 FC p
Endometriosis -2.391 9.0e-03
adrenocortical carcinoma -2.179 2.4e-05
Atopic dermatitis -2.300 1.8e-04
Breast cancer -2.400 3.3e-02
breast carcinoma -2.100 9.6e-04
chronic lymphosyte leukemia -1.300 1.6e-10
colon cancer -1.800 7.4e-03
Duchenne muscular dystrophy 1.073 1.2e-03
ductal carcinoma in situ -3.600 8.0e-05
fibroadenoma -2.500 3.1e-03
intraductal papillary-mucinous adenoma (... -3.400 3.4e-06
intraductal papillary-mucinous carcinoma... -2.400 3.2e-02
invasive ductal carcinoma -2.674 9.2e-05
limb girdle muscular dystrophy 2A 1.177 6.6e-04
lung adenocarcinoma -1.100 1.5e-12
lung cancer -1.500 3.6e-04
lung carcinoma -2.000 7.1e-27
malignant mesothelioma 1.100 2.2e-05
non primary Sjogren syndrome sicca 1.500 2.5e-02
non-small cell lung cancer -3.032 1.1e-26
ovarian cancer -3.400 2.7e-12
psoriasis -1.600 1.1e-05
tuberculosis 1.400 1.0e-07

 MGI Phenotype (1)

PDB (25)

Gene RIF (21)

AA Sequence

MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLED      1 - 70
AADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDR     71 - 140
DVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSGG    141 - 210
PLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA                               211 - 253
//

Text Mined References (43)

PMID Year Title