Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.11
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3578 9.2e-04
psoriasis 6694 4.5e-03
cutaneous lupus erythematosus 1057 5.2e-03
chronic rhinosinusitis 512 2.6e-02
ependymoma 4679 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.100 9.2e-04
chronic rhinosinusitis -1.219 2.6e-02
cutaneous lupus erythematosus -1.300 5.2e-03
ependymoma 2.500 2.6e-02
psoriasis -1.200 4.5e-03

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MWTEEAGATAEAQESGIRNKSSSSSQIPVVGVVTEDDEAQDVFKPMDLNRVIKLLEETDKDGLEEKQLKF      1 - 70
VKKLVQCYQNGLPLRDLAQIFKILNLCSGKIKNQPRFIESAYDIIKLCGLPFLKKKVSDEITYAEDTANS     71 - 140
IALLGDLMKIPSSELRIQICKCIVDFYHAEPPKKHIPGYQQASSSYKIQMAEVGGLAKTMVQSMTLLENQ    141 - 210
LVEKLWVLKVLQHLSTSEVNCTIMMKAQAASGICTHLNDPDPSGQLLFRSSEILWNLLEKSSKEEVIQQL    211 - 280
SNLECLLALKEVFKNLFMRGFSHYDRQLRNDILVITTIIAQNPEAPMIECGFTKDLILFATFNEVKSQNL    281 - 350
LVKGLKLSNSYEDFELKKLLFNVIVILCKDLPTVQLLIDGKVILALFTYVKKPEKQKIIDWSAAQHEELQ    351 - 420
LHAIATLSSVAPLLIEEYMSCQGNARVLAFLEWCESEDPFFSHGNSFHGTGGRGNKFAQMRYSLRLLRAV    421 - 490
VYLEDETVNKDLCEKGTIQQMIGIFKNIISKPNEKEEAIVLEIQSDILLILSGLCENHIQRKEIFGTEGV    491 - 560
DIVLHVMKTDPRKLQSGLGYNVLLFSTLDSIWCCILGCYPSEDYFLEKEGIFLLLDLLALNQKKFCNLIL    561 - 630
GIMVEFCDNPKTAAHVNAWQGKKDQTAASLLIKLWRKEEKELGVKRDKNGKIIDTKKPLFTSFQEEQKII    631 - 700
PLPANCPSIAVMDVSENIRAKIYAILGKLDFENLPGLSAEDFVTLCIIHRYLDFKIGEIWNEIYEEIKLE    701 - 770
KLRPVTTDKKALEAITTASENIGKMVASLQSDIIESQACQDMQNEQKVYAKIQATHKQRELANKSWEDFL    771 - 840
ARTSNAKTLKKAKSLQEKAIEASRYHKRPQNAIFHQTHIKGLNTTVPSGGVVTVESTPARLVGGPLVDTD    841 - 910
IALKKLPIRGGALQRVKAVKIVDAPKKSIPT                                           911 - 941
//

Text Mined References (7)

PMID Year Title