Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.11
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3578 9.2e-04
psoriasis 6694 4.5e-03
cutaneous lupus erythematosus 1057 5.2e-03
chronic rhinosinusitis 512 2.6e-02
ependymoma 4679 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.100 9.2e-04
chronic rhinosinusitis -1.219 2.6e-02
cutaneous lupus erythematosus -1.300 5.2e-03
ependymoma 2.500 2.6e-02
psoriasis -1.200 4.5e-03

Synonym

Accession A5D8W1 A3KMP9 B4DYW6 B4DZP7 B9EIM7 Q6V705 Q8IY89 Q9H7C2
Symbols FAP69
C7orf63

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MWTEEAGATAEAQESGIRNKSSSSSQIPVVGVVTEDDEAQDVFKPMDLNRVIKLLEETDKDGLEEKQLKF      1 - 70
VKKLVQCYQNGLPLRDLAQIFKILNLCSGKIKNQPRFIESAYDIIKLCGLPFLKKKVSDEITYAEDTANS     71 - 140
IALLGDLMKIPSSELRIQICKCIVDFYHAEPPKKHIPGYQQASSSYKIQMAEVGGLAKTMVQSMTLLENQ    141 - 210
LVEKLWVLKVLQHLSTSEVNCTIMMKAQAASGICTHLNDPDPSGQLLFRSSEILWNLLEKSSKEEVIQQL    211 - 280
SNLECLLALKEVFKNLFMRGFSHYDRQLRNDILVITTIIAQNPEAPMIECGFTKDLILFATFNEVKSQNL    281 - 350
LVKGLKLSNSYEDFELKKLLFNVIVILCKDLPTVQLLIDGKVILALFTYVKKPEKQKIIDWSAAQHEELQ    351 - 420
LHAIATLSSVAPLLIEEYMSCQGNARVLAFLEWCESEDPFFSHGNSFHGTGGRGNKFAQMRYSLRLLRAV    421 - 490
VYLEDETVNKDLCEKGTIQQMIGIFKNIISKPNEKEEAIVLEIQSDILLILSGLCENHIQRKEIFGTEGV    491 - 560
DIVLHVMKTDPRKLQSGLGYNVLLFSTLDSIWCCILGCYPSEDYFLEKEGIFLLLDLLALNQKKFCNLIL    561 - 630
GIMVEFCDNPKTAAHVNAWQGKKDQTAASLLIKLWRKEEKELGVKRDKNGKIIDTKKPLFTSFQEEQKII    631 - 700
PLPANCPSIAVMDVSENIRAKIYAILGKLDFENLPGLSAEDFVTLCIIHRYLDFKIGEIWNEIYEEIKLE    701 - 770
KLRPVTTDKKALEAITTASENIGKMVASLQSDIIESQACQDMQNEQKVYAKIQATHKQRELANKSWEDFL    771 - 840
ARTSNAKTLKKAKSLQEKAIEASRYHKRPQNAIFHQTHIKGLNTTVPSGGVVTVESTPARLVGGPLVDTD    841 - 910
IALKKLPIRGGALQRVKAVKIVDAPKKSIPT                                           911 - 941
//

Text Mined References (7)

PMID Year Title