Property Summary

NCBI Gene PubMed Count 25
PubMed Score 28.47
PubTator Score 19.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
Rheumatoid Arthritis 1.300 1.5e-02
malignant mesothelioma -1.500 3.2e-06
ependymoma -1.800 2.9e-02
psoriasis -1.700 4.1e-10
cutaneous lupus erythematosus -1.300 2.4e-03
osteosarcoma 2.083 6.7e-05
cystic fibrosis 1.140 3.9e-04
glioblastoma -1.400 3.4e-06
medulloblastoma, large-cell 1.900 2.2e-03
tuberculosis 1.800 5.5e-09
non-small cell lung cancer 2.150 1.2e-19
intraductal papillary-mucinous adenoma (... 1.700 5.4e-03
intraductal papillary-mucinous carcinoma... 1.900 5.6e-03
intraductal papillary-mucinous neoplasm ... 2.200 3.1e-03
lung cancer 2.400 1.0e-04
pancreatic cancer 1.400 1.1e-05
diabetes mellitus -1.200 1.6e-03
Breast cancer 3.400 2.2e-02
group 4 medulloblastoma 1.900 2.7e-04
pilocytic astrocytoma -1.100 1.2e-03
lung adenocarcinoma 1.433 3.7e-08
lung carcinoma 1.600 8.2e-25
breast carcinoma 1.900 4.9e-36
ductal carcinoma in situ 2.100 8.8e-04
invasive ductal carcinoma 2.900 7.2e-05
ovarian cancer 1.400 1.4e-03
pituitary cancer 2.000 5.0e-07

Gene RIF (18)

PMID Text
26887952 These results suggest that the phosphorylation of ceramide synthases may be a key regulatory point in the control of the distribution and levels of sphingolipids of various acyl-chain lengths.
26783755 Identification of CerS6 and ceramide pathways as a novel Methotrexate target.
26650179 CERS6-dependent ceramide synthesis and maintenance of ceramide in the cellular membrane are essential for lamellipodia formation and metastasis.
26318294 stichoposide D inhibits growth of experimental leukemia by activating Fas/ceramide synthase 6/p38 kinase in lipid rafts
25839235 Taken together, these results suggest that increased expression of CerS6 can mediate transcriptional activation of acid ceramidase in a JNK-dependent manner that is independent of CerS6 activity.
25833068 Data indicate that ceramide synthase 6 (CerS6) expression is upregulated in leukocytes from multiple sclerosis (MS) patients.
25766330 On the basis of its pivotal role in regulating cell death upon COX dysfunction, CerS6 might potentially represent a novel target for therapeutic intervention in mitochondrial diseases caused by COX dysfunction.
25173988 Upregulation of CERS6 in an experimental autoimmune encephalomyelitis model is sex dependent.
24632610 CerS6 as a novel epithelial-mesenchymal transition-regulated gene that has a pivotal role in the regulation of cell migration.
23538298 Co-expression of CerS2 with CerS4/CerS6 reversed the inhibitory effect of long chain ceramides on cell proliferation and the induction of apoptosis. we detected no effect on cell proliferation.
23519469 folate withdrawal also induced CerS6/C16-ceramide elevation accompanied by p53 accumulation. Overall, these novel findings link folate and de novo ceramide pathways in cellular stress response.
22544924 The transiently increased expression of ceramide synthase (CerS6) correlates to the clinical finding that C(16:0)-Cer levels are increased 1.9-fold in cerebrospinal fluid of multiple sclerosis patients.
22013072 Alteration of ceramide synthase 6/C16-ceramide induces activating transcription factor 6-mediated endoplasmic reticulum (ER) stress and apoptosis via perturbation of cellular Ca2+ and ER/Golgi membrane network
20406683 ionizing radiation induces de novo synthesis of ceramide to influence HeLa cell apoptosis by specifically activating CerS isoforms 2, 5, and 6 that generate opposing anti- and pro-apoptotic ceramides in mitochondrial membranes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20103619 Findings indicate that mda-7/IL-24 induces PERK activation that triggers production of ceramide, ceramide synthase 6 and thioredoxin, which in turn promote glioma cell autophagy and cell death.
19912991 CerS2 and CerS6 mRNA was significantly elevated in breast cancer tissue compared to paired normal tissue, with approximately half of the individuals showing elevated CerS2 and CerS6 mRNA.
19723703 Mechanistically, regulation of ER-stress-induced apoptosis by CerS6/C(16)-ceramide was linked to the activation of a specific arm, ATF6/CHOP, of the unfolded protein response pathway.

AA Sequence

MAGILAWFWNERFWLPHNVTWADLKNTEEATFPQAEDLYLAFPLAFCIFMVRLIFERFVAKPCAIALNIQ      1 - 70
ANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTRFCESMWRFS     71 - 140
FYLYVFTYGVRFLKKTPWLWNTRHCWYNYPYQPLTTDLHYYYILELSFYWSLMFSQFTDIKRKDFGIMFL    141 - 210
HHLVSIFLITFSYVNNMARVGTLVLCLHDSADALLEAAKMANYAKFQKMCDLLFVMFAVVFITTRLGIFP    211 - 280
LWVLNTTLFESWEIVGPYPSWWVFNLLLLLVQGLNCFWSYLIVKIACKAVSRGKVSKDDRSDIESSSDEE    281 - 350
DSEPPGKNPHTATTTNGTSGTNGYLLTGSCSMDD                                        351 - 384
//

Text Mined References (27)

PMID Year Title
26887952 2016 Enzyme Activities of the Ceramide Synthases CERS2-6 Are Regulated by Phosphorylation in the C-terminal Region.
26783755 2016 Ceramide Synthase 6 Is a Novel Target of Methotrexate Mediating Its Antiproliferative Effect in a p53-Dependent Manner.
26650179 2016 Targeting ceramide synthase 6-dependent metastasis-prone phenotype in lung cancer cells.
26318294 2015 By activating Fas/ceramide synthase 6/p38 kinase in lipid rafts, stichoposide D inhibits growth of leukemia xenografts.
25839235 2015 Expression of Ceramide Synthase 6 Transcriptionally Activates Acid Ceramidase in a c-Jun N-terminal Kinase (JNK)-dependent Manner.
25833068 2015 Exacerbation of experimental autoimmune encephalomyelitis in ceramide synthase 6 knockout mice is associated with enhanced activation/migration of neutrophils.
25766330 2015 Cytochrome c oxidase deficiency accelerates mitochondrial apoptosis by activating ceramide synthase 6.
25173988 2014 Regulation of ceramide synthase 6 in a spontaneous experimental autoimmune encephalomyelitis model is sex dependent.
24632610 2015 Downregulation of ceramide synthase-6 during epithelial-to-mesenchymal transition reduces plasma membrane fluidity and cancer cell motility.
23538298 2013 The equilibrium between long and very long chain ceramides is important for the fate of the cell and can be influenced by co-expression of CerS.
23519469 2013 Folate stress induces apoptosis via p53-dependent de novo ceramide synthesis and up-regulation of ceramide synthase 6.
22544924 2012 Ceramide synthase 6 plays a critical role in the development of experimental autoimmune encephalomyelitis.
22013072 2011 Alteration of ceramide synthase 6/C16-ceramide induces activating transcription factor 6-mediated endoplasmic reticulum (ER) stress and apoptosis via perturbation of cellular Ca2+ and ER/Golgi membrane network.
20406683 2010 Ceramide synthases 2, 5, and 6 confer distinct roles in radiation-induced apoptosis in HeLa cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20103619 2010 PERK-dependent regulation of ceramide synthase 6 and thioredoxin play a key role in mda-7/IL-24-induced killing of primary human glioblastoma multiforme cells.
19946888 2010 Defining the membrane proteome of NK cells.
19912991 2010 Increased ceramide synthase 2 and 6 mRNA levels in breast cancer tissues and correlation with sphingosine kinase expression.
19723703 2010 Antiapoptotic roles of ceramide-synthase-6-generated C16-ceramide via selective regulation of the ATF6/CHOP arm of ER-stress-response pathways.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18615156 Genome-wide association scan identifies candidate polymorphisms associated with differential response to anti-TNF treatment in rheumatoid arthritis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.