Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.131 3.2e-02
atypical teratoid / rhabdoid tumor 1.100 2.1e-02
glioblastoma 1.100 5.4e-05
group 3 medulloblastoma 1.100 4.6e-02
intraductal papillary-mucinous neoplasm ... 1.300 4.6e-02
osteosarcoma -1.066 2.3e-03
ovarian cancer -1.300 5.9e-06
Pick disease -1.300 6.3e-04
primitive neuroectodermal tumor 1.100 9.8e-04
progressive supranuclear palsy -1.400 1.7e-02

AA Sequence

MATGDLKRSLRNLEQVLRLLNYPEEVDCVGLIKGDPAASLPIISYSFTSYSPYVTELIMESNVELIAKND      1 - 70
LRFIDAVYKLLRDQFNYKPILTKKQFIQCGFAEWKIQIVCDILNCVMKKHKELSSLQKIPSQQRKKISSG     71 - 140
KSEPPLGNEKISAEAVGVDISGRFMTSGKKKAVVIRHLYNEDNVDISEDTLSPITDVNEAVDVSDLNATE    141 - 210
IKMPEVKVPEIKAEQQDVNVNPEITALQTMLAECQENLKKLTSIEKRLDCLEQKMKGKVMVDENTWTNLL    211 - 280
SRVTLLETEMLLSKKNDEFIEFNEVSEDYASCSDMDLLNPHRKSEVERPASIPLSSGYSTASSDSTPRAS    281 - 350
TVNYCGLNEISEETTIQKMERMKKMFEETAELLKCPNHYL                                  351 - 390
//

Text Mined References (17)

PMID Year Title