Property Summary

NCBI Gene PubMed Count 28
PubMed Score 18.02
PubTator Score 18.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

 GO Function (1)

Gene RIF (12)

PMID Text
24997597 Plk4 is intricately regulated in time and space through ordered interactions with two distinct scaffolds, Cep192 and Cep152, and a failure in this process may lead to human cancer.
24277814 Loss of the Cep192- or Cep152-dependent interaction with Plk4 resulted in impaired centriole duplication that led to delayed cell proliferation.
24137814 Found that both sc-54 and ab18 antibodies recognize not only Cdk1 but also Cep152 in Western blot and immunofluorescence assays.
23936128 both mouse and human Cep63 and Cep152 cooperate to ensure efficient centriole duplication by promoting the accumulation of essential centriole duplication factors upstream of SAS-6 recruitment and procentriole formation.
23641073 cooperation between Cep192 and Cep152 is crucial for centriole recruitment of Plk4 and centriole duplication during the cell cycle.
23333316 Cep57, Cep63, and Cep152 are parts of a ring-like complex localizing around the proximal end of centrioles.
21131973 CEP152 is a genome maintenance protein disrupted in Seckel syndrome
21059850 Data show that Cep152 can be phosphorylated by Plk4 in vitro, suggesting that Cep152 acts with Plk4 to initiate centriole formation.
21059844 Results suggest that Cep152 recruits Plk4 and CPAP to the centrosome to ensure a faithful centrosome duplication process.
20852615 Drosophila Asl and human CEP152 are required for the centrosomal loading of Plk4 in Drosophila and CPAP in human cells, respectively
20598275 CEP152 is a strong candidate for the causal gene underlying MCPH4 and may be an important gene in the evolution of human brain size.
20547088 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MSLDFGSVALPVQNEDEEYDEEDYEREKELQQLLTDLPHDMLDDDLSSPELQYSDCSEDGTDGQPHHPEQ      1 - 70
LEMSWNEQMLPKSQSVNGYNEIQSLYAGEKCGNVWEENRSKTEDRHPVYHPEEGGDEGGSGYSPPSKCEQ     71 - 140
TDLYHLPENFRPYTNGQKQEFNNQATNVIKFSDPQWNHFQGPSCQGLEPYNKVTYKPYQSSAQNNGSPAQ    141 - 210
EITGSDTFEGLQQQFLGANENSAENMQIIQLQVLNKAKERQLENLIEKLNESERQIRYLNHQLVIIKDEK    211 - 280
DGLTLSLRESQKLFQNGKEREIQLEAQIKALETQIQALKVNEEQMIKKSRTTEMALESLKQQLVDLHHSE    281 - 350
SLQRAREQHESIVMGLTKKYEEQVLSLQKNLDATVTALKEQEDICSRLKDHVKQLERNQEAIKLEKTEII    351 - 420
NKLTRSLEESQKQCAHLLQSGSVQEVAQLQFQLQQAQKAHAMSANMNKALQEELTELKDEISLYESAAKL    421 - 490
GIHPSDSEGELNIELTESYVDLGIKKVNWKKSKVTSIVQEEDPNEELSKDEFILKLKAEVQRLLGSNSMK    491 - 560
RHLVSQLQNDLKDCHKKIEDLHQVKKDEKSIEVETKTDTSEKPKNQLWPESSTSDVVRDDILLLKNEIQV    561 - 630
LQQQNQELKETEGKLRNTNQDLCNQMRQMVQDFDHDKQEAVDRCERTYQQHHEAMKTQIRESLLAKHALE    631 - 700
KQQLFEAYERTHLQLRSELDKLNKEVTAVQECYLEVCREKDNLELTLRKTTEKEQQTQEKIKEKLIQQLE    701 - 770
KEWQSKLDQTIKAMKKKTLDCGSQTDQVTTSDVISKKEMAIMIEEQKCTIQQNLEQEKDIAIKGAMKKLE    771 - 840
IELELKHCENITKQVEIAVQNAHQRWLGELPELAEYQALVKAEQKKWEEQHEVSVNKRISFAVSEAKEKW    841 - 910
KSELENMRKNILPGKELEEKIHSLQKELELKNEEVPVVIRAELAKARSEWNKEKQEEIHRIQEQNEQDYR    911 - 980
QFLDDHRNKINEVLAAAKEDFMKQKTELLLQKETELQTCLDQSRREWTMQEAKRIQLEIYQYEEDILTVL    981 - 1050
GVLLSDTQKEHISDSEDKQLLEIMSTCSSKWMSVQYFEKLKGCIQKAFQDTLPLLVENADPEWKKRNMAE   1051 - 1120
LSKDSASQGTGQGDPGPAAGHHAQPLALQATEAEADKKKVLEIKDLCCGHCFQELEKAKQECQDLKGKLE   1121 - 1190
KCCRHLQHLERKHKAVVEKIGEENNKVVEELIEENNDMKNKLEELQTLCKTPPRSLSAGAIENACLPCSG   1191 - 1260
GALEELRGQYIKAVKKIKCDMLRYIQESKERAAEMVKAEVLRERQETARKMRKYYLICLQQILQDDGKEG   1261 - 1330
AEKKIMNAASKLATMAKLLETPISSKSQSKTTQSALPLTSEMLIAVKKSKRNDVNQKIPCCIESKSNSVN   1331 - 1400
TITRTLCEQAPKRRAACNLQRLLENSEHQSIKHVGSKETHLEFQFGDGSCKHLNSLPRNVSPEFVPCEGE   1401 - 1470
GGFGLHKKKDLLSDNGSESLPHSAAYPFLGTLGNKPSPRCTPGPSESGCMHITFRDSNERLGLKVYKCNP   1471 - 1540
LMESENAASEKSQGLDVQEPPVKDGGDLSDCLGWPSSSATLSFDSREASFVHGRPQGTLEIPSESVKSKQ   1541 - 1610
FSPSGYLSDTEESNMICQTMKCQRYQTPYLSEETTYLEPGKISVNCGHPSRHKADRLKSDFKKLSSTLPS   1611 - 1680
SVCQQPSRKLIVPLSSQQDSGFDSPFVNLD                                           1681 - 1710
//

Text Mined References (33)

PMID Year Title
26337392 2015 MDM1 is a microtubule-binding protein that negatively regulates centriole duplication.
26297806 2015 Centriolar satellites assemble centrosomal microcephaly proteins to recruit CDK2 and promote centriole duplication.
24997597 2014 Molecular basis for unidirectional scaffold switching of human Plk4 in centriole biogenesis.
24613305 2014 Proximity interactions among centrosome components identify regulators of centriole duplication.
24277814 2013 Hierarchical recruitment of Plk4 and regulation of centriole biogenesis by two centrosomal scaffolds, Cep192 and Cep152.
24137814 2013 Commercial Cdk1 antibodies recognize the centrosomal protein Cep152.
23936128 2013 Cep63 and cep152 cooperate to ensure centriole duplication.
23728906 2013 A genome-wide association study of sleep habits and insomnia.
23641073 2013 Human Cep192 and Cep152 cooperate in Plk4 recruitment and centriole duplication.
23333316 2013 Selective chemical crosslinking reveals a Cep57-Cep63-Cep152 centrosomal complex.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
22020124 2011 The human microcephaly protein STIL interacts with CPAP and is required for procentriole formation.
21983783 2011 A primary microcephaly protein complex forms a ring around parental centrioles.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21131973 2011 CEP152 is a genome maintenance protein disrupted in Seckel syndrome.
21059850 2010 Cep152 interacts with Plk4 and is required for centriole duplication.
21059844 2010 Cep152 acts as a scaffold for recruitment of Plk4 and CPAP to the centrosome.
20852615 2010 Asterless is a scaffold for the onset of centriole assembly.
20598275 2010 Mutations in centrosomal protein CEP152 in primary microcephaly families linked to MCPH4.
20547088 2010 A Japanese-specific allele in the GALNT11 gene.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14654843 2003 Proteomic characterization of the human centrosome by protein correlation profiling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
10521316 1999 Primary autosomal recessive microcephaly: homozygosity mapping of MCPH4 to chromosome 15.
10409428 1999 Gene expression in proliferating human erythroid cells.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.