Property Summary

NCBI Gene PubMed Count 12
PubMed Score 17.47
PubTator Score 4.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
aldosterone-producing adenoma -1.034 5.5e-03
gastric cancer 1.100 5.2e-03
lung adenocarcinoma -1.100 4.2e-12
lung cancer -1.100 7.0e-04
osteosarcoma 1.378 1.4e-06
pancreatic cancer 1.100 7.7e-03
pancreatic carcinoma 1.100 7.7e-03
psoriasis -1.200 5.2e-07
tuberculosis and treatment for 6 months -1.300 4.4e-03

Gene RIF (2)

AA Sequence

MPHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPRFCQFPQEIVLQMVERCRIRKLQLLAHQYMISS      1 - 70
KIEFYISESLPEYFAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDAVGQFLKLIFHQNHVNKYNIY     71 - 140
NQVALVAINIIGDPADFSDESNTASREKLIDHYLGHNSEDPALEGTYARKSDYISPLDDLAFDMYQDPEV    141 - 210
AQIIRKLDERKREAVQKERYDYAKKLKQAIADLQKVGERLGRYEVEKRCAVEKEDYDLAKEKKQQMEQYR    211 - 280
AEVYEQLELHSLLDAELMRRPFDLPLQPLARSGSPCHQKPMPSLPQLEERGTENQFAEPFLQEKPSSYSL    281 - 350
TISPQHSAVDPLLPATDPHPKINAESLPYDERPLPAIRKHYGEAVVEPEMSNADISDARRGGMLGEPEPL    351 - 420
TEKALREASSAIDVLGETLVAEAYCKTWSYREDALLALSKKLMEMPVGTPKEDLKNTLRASVFLVRRAIK    421 - 490
DIVTSVFQASLKLLKMIITQYIPKHKLSKLETAHCVERTIPVLLTRTGDSSARLRVTAANFIQEMALFKE    491 - 560
VKSLQIIPSYLVQPLKANSSVHLAMSQMGLLARLLKDLGTGSSGFTIDNVMKFSVSALEHRVYEVRETAV    561 - 630
RIILDMYRQHQASILEYLPPDDSNTRRNILYKTIFEGFAKIDGRATDAEMRARRKAATEEAEKQKKEEIK    631 - 700
ALQGQLAALKEIQAEVQEKESDAVKPKNQDIQGGKAAPAEALGIPDEHYLDNLCIFCGERSESFTEEGLD    701 - 770
LHYWKHCLMLTRCDHCKQVVEISSLTEHLLTECDKKDGFGKCYRCSEAVFKEELPRHIKHKDCNPAKPEK    771 - 840
LANRCPLCHENFSPGEEAWKAHLMGPAGCTMNLRKTHILQKAPALQPGKSSAVAASGPLGSKAGSKIPTP    841 - 910
KGGLSKSSSRTYAKR                                                           911 - 925
//

Text Mined References (12)

PMID Year Title