Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.73
PubTator Score 2.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Protein-protein Interaction (1)

Gene RIF (1)

AA Sequence

MDSYSAPESTPSASSRPEDYFIGATPLQKRLESVRKQSSFILTPPRRKIPQCSQLQEDVDPQKVAFLLHK      1 - 70
QWTLYSLTPLYKFSYSNLKEYSRLLNAFIVAEKQKGLAVEVGEDFNIKVIFSTLLGMKGTQRDPEAFLVQ     71 - 140
IVSKSQLPSENREGKVLWTGWFCCVFGDSLLETVSEDFTCLPLFLANGAESNTAIIGTWFQKTFDCYFSP    141 - 210
LAINAFNLSWMAAMWTACKMDHYVATTEFLWSVPCSPQSLDISFAIHPEDAKALWDSVHKTPGEVTQEEV    211 - 280
DLFMDCLYSHFHRHFKIHLSATRLVRVSTSVASAHTDGKIKILCHKYLIGVLAYLTELAIFQIE          281 - 344
//

Text Mined References (14)

PMID Year Title