Property Summary

NCBI Gene PubMed Count 32
PubMed Score 32.71
PubTator Score 36.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.961 1.2e-03
posterior fossa group A ependymoma 1.700 1.6e-07
glioblastoma 2.400 5.1e-09
group 3 medulloblastoma 3.300 1.5e-07
atypical teratoid/rhabdoid tumor 2.000 1.3e-09
medulloblastoma, large-cell 3.200 1.8e-08
primitive neuroectodermal tumor 2.800 1.5e-06
adrenocortical carcinoma 1.726 1.7e-04
non-small cell lung cancer 1.835 1.3e-18
pediatric high grade glioma 2.200 1.7e-07
nasopharyngeal carcinoma 1.500 1.4e-04

 GO Function (1)

Gene RIF (20)

PMID Text
26378239 propose that CSPP1 cooperates with CENP-H on kinetochores to serve as a novel regulator of kinetochore microtubule dynamics for accurate chromosome segregation
26248586 Upregulation of centromere protein H is associated with progression of renal cell carcinoma
23970101 CENP-H was overexpressed in HCC, and its level of upregulation was an independent prognostic indicator, suggesting that CENP-H may be an effective therapeutic strategy for the treatment of HCC.
22999412 High expression of CENP-H in gastric cancer indicates poor prognosis and Survivin may mediate its procancer role.
22682030 Sp1 and Sp3 bind to the CENPH minimal promoter and function as a regulator of the transcription of CENPH in nasopharyngeal carcinomas.
22631655 upregulated CENP-H and Ki67 levels are significantly associated with short relapse-free survival in hypopharyngeal squamous cell carcinoma (HSSC); these factors may be predictors of a relapsing phenotype in HSSC cases
22381774 CENP-H promotes the proliferation of human gastric cancer cells
21880184 Breast cancer patients with high CENP-H expression had short overall survival. CENP-H expression was related with clinical stage.
21875947 HIV-1 Vpr and p300/HAT co-localizes with CENP-A and CENP-H proteins in the centromere and arm region of chromosome
19625449 CENP-H-containing complex facilitates deposition of newly synthesized CENP-A into centromeric chromatin in cooperation with FACT and CHD1.
19500341 Upregulation of CENP-H in tongue cancer is associated with disease progression.
19232519 TRIM36 has a ubiquitin ligase activity and interacts with centromere protein-H.
19170237 expression of CENPH was much higher in cancer cell lines & lung cancer tissue than normal cells & adjacent noncancerous lung tissues; results show that high CENPH protein expression was related to poor outcome in patients with nonsmall cell lung cancer
18700042 CENP-H protein has a role in esophageal carcinoma progression
18045986 the vertebrate KNL1 counterpart is essential for chromosome segregation and is required to localize a subset of outer kinetochore proteins.
17651496 CENP-C and CENP-H co-localize to the CENP-A chromatin domain.
17255272 CENP-H has a role in preventing progression of nasopharyngeal carcinoma
16875666 has an important impact on the architecture and function of the human kinetochore complex
16622420 The CENP-H-I complex may function, in part, as a marker directing CENP-A deposition to centromeres.
15930286 CENP-H is up-regulated and plays an important role in the aneuploidy frequently observed in colorectal cancers.

AA Sequence

MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPE      1 - 70
QIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLI     71 - 140
MKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITT    141 - 210
VIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM                                     211 - 247
//

Text Mined References (39)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26378239 2015 Mitotic Protein CSPP1 Interacts with CENP-H Protein to Coordinate Accurate Chromosome Oscillation in Mitosis.
26248586 2015 Upregulation of centromere protein H is associated with progression of renal cell carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
23970101 2013 Overexpression of CENP-H as a novel prognostic biomarker for human hepatocellular carcinoma progression and patient survival.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22999412 2013 Combined evaluation of centromere protein H and Ki-67 as prognostic biomarker for patients with gastric carcinoma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22682030 2012 Sp1 and Sp3 are involved in the full transcriptional activity of centromere protein H in human nasopharyngeal carcinoma cells.
22631655 2012 Role of centromere protein H and Ki67 in relapse-free survival of patients after primary surgery for hypopharyngeal cancer.
22381774 2012 [Role of centromere protein H in human gastric cancer cell proliferation].
21880184 2011 Overexpression of centromere protein H is significantly associated with breast cancer progression and overall patient survival.
20212317 2010 The SUMO protease SENP6 is essential for inner kinetochore assembly.
19625449 2009 CENP-H-containing complex facilitates centromere deposition of CENP-A in cooperation with FACT and CHD1.
19500341 2009 Upregulation of CENP-H in tongue cancer correlates with poor prognosis and progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19381461 2009 CENP-K and CENP-H may form coiled-coils in the kinetochores.
19232519 2009 TRIM36 interacts with the kinetochore protein CENP-H and delays cell cycle progression.
19170237 2009 Centromere protein H is a novel prognostic marker for human nonsmall cell lung cancer progression and overall patient survival.
18700042 2008 Prognostic relevance of Centromere protein H expression in esophageal carcinoma.
18045986 2008 KNL1 and the CENP-H/I/K complex coordinately direct kinetochore assembly in vertebrates.
18007590 2007 The CENP-A NAC/CAD kinetochore complex controls chromosome congression and spindle bipolarity.
17651496 2007 Co-localization of CENP-C and CENP-H to discontinuous domains of CENP-A chromatin at human neocentromeres.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17255272 2007 Centromere protein H is a novel prognostic marker for nasopharyngeal carcinoma progression and overall patient survival.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16875666 2006 RNAi knockdown of human kinetochore protein CENP-H.
16716197 2006 Comprehensive analysis of the ICEN (Interphase Centromere Complex) components enriched in the CENP-A chromatin of human cells.
16622420 2006 The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.
16622419 2006 The human CENP-A centromeric nucleosome-associated complex.
15930286 2005 Centromere protein H is up-regulated in primary human colorectal cancer and its overexpression induces aneuploidy.
15713649 2005 The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis.
15502821 2004 A conserved Mis12 centromere complex is linked to heterochromatic HP1 and outer kinetochore protein Zwint-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14536089 2003 Transcription within a functional human centromere.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11092768 2000 Human CENP-H multimers colocalize with CENP-A and CENP-C at active centromere--kinetochore complexes.