Property Summary

NCBI Gene PubMed Count 63
PubMed Score 135.79
PubTator Score 129.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
glioblastoma 2.000 1.9e-05
group 3 medulloblastoma 2.700 4.7e-05
atypical teratoid / rhabdoid tumor 2.100 3.2e-08
medulloblastoma, large-cell 2.500 1.3e-05
primitive neuroectodermal tumor 2.500 1.6e-05
Atopic dermatitis 1.400 6.3e-05
adrenocortical carcinoma 1.455 9.3e-05
non-small cell lung cancer 2.332 8.5e-30
intraductal papillary-mucinous carcinoma... 1.600 6.8e-05
intraductal papillary-mucinous neoplasm ... 2.300 2.3e-04
lung cancer 4.700 2.3e-07
colon cancer 1.900 1.2e-03
Breast cancer 2.800 3.0e-02
lung adenocarcinoma 1.300 2.2e-08
pediatric high grade glioma 1.700 1.8e-05
primary Sjogren syndrome 1.100 5.2e-03
nasopharyngeal carcinoma 1.100 2.2e-04
psoriasis 1.900 2.2e-58
Endometriosis 1.229 1.2e-02
ductal carcinoma in situ 1.700 1.1e-03
invasive ductal carcinoma 2.200 4.7e-05
ovarian cancer 2.000 5.4e-12

Gene RIF (37)

PMID Text
26321640 CTCF helps recruit CENP-E to the centromere during mitosis and that it may do so through a structure stabilized by the CTCF/CENP-E complex.
25908662 CENP-E-driven chromosome congression is guided by microtubule detyrosination.
25743205 Chromokinesin Kid and kinetochore kinesin CENP-E differentially support chromosome congression without end-on attachment to microtubules.
25395579 CENP-Q - a subunit of the CENP-O complex (comprising CENP-O, CENP-P, CENP-Q and CENP-U) that targets polo-like kinase (Plk1) to kinetochores - is also required for the recruitment of CENP-E to kinetochores.
25383660 dynein and CENP-E at kinetochores drive congression of peripheral polar chromosomes by preventing arm-ejection forces mediated by chromokinesins from working in the wrong direction.
24928852 CENP-E expression is highest in basal-like subtype among breast cancer patients.
24920822 An unexpected role of CENP-E elongated stalk in ensuring stability of kinetochore-microtubule attachments during chromosome congression and segregation.
24748105 Mutations in CENPE define a novel kinetochore-centromeric mechanism for microcephalic primordial dwarfism.
23955301 Kinetochore kinesin CENP-E is a processive bi-directional tracker of dynamic microtubule tips.
23891108 A CENP-E mediated wall-tethering event and a MCAK-mediated wall-removing event show that human chromosome-microtubule attachment is achieved through a set of deterministic sequential events rather than stochastic direct capture of microtubule ends.
23740391 The changes in ATP binding affinity and conformational deviations in human CENP-E motor domain, were studied.
23236152 Evolutionarily conserved protein ERH controls CENP-E mRNA splicing and is required for the survival of KRAS mutant cancer cells.
22974711 In this study we investigated the pathogenic effect of 132 nsSNPs reported in CENP-E using computational platform.
22801780 It was shown that the state of CENP-E-dependent BubR1 autophosphorylation in response to spindle microtubule capture by CENP-E is important for kinetochore function in achieving accurate chromosome segregation.
22637578 the unusually slow CENP-E microtubule association step favors CENP-E binding of stable microtubules over dynamic ones, a mechanism that would bias CENP-E binding to kinetochore fibers.
22307330 Data show that CENP-E-mediated traction forces on misaligned chromosomes are responsible for the irreversible loss of spindle-pole integrity in CLASP1/2-depleted cells.
22110139 SKAP cooperates with CENP-E to orchestrate dynamic kinetochore-microtubule interaction for faithful chromosome segregation.
20691903 An Aurora/PP1 phosphorylation switch modulates CENP-E motor activity as a feature of chromosome congression from poles and localized PP1 delivery by CENP-E to the outer kinetochore is necessary for stable microtubule capture by those chromosomes.
20354862 Aurora B allowed chromosome alignment in CENP-E-compromised cells; implied that by destabilizing pole proximal syntelic attachments, Aurora B cooperates with CENP-E to mediate congression of mono-oriented polar chromosomes
20332099 Observational study of gene-disease association. (HuGE Navigator)
20237434 Targeting of CENP-E and BubR1 to the kinetochores and the interaction between CENP-E and BubR1 are significantly reduced in EpoB-resistant A549 cell line, compared to A549 cells.
20021663 CENP-E expression was reduced in human hepatocellular carcinoma
19733075 CENP-E integrates two critical functions that are important for accurate chromosome movement and spindle architecture: one relying directly on its motor activity, and the other involving the targeting of key microtubule regulators to kinetochores.
19723035 Study analyzed the distribution of PARP-1 and its interaction with CENP-B, -E, and -F during mitosis and apoptosis.
19625775 Studies strongly suggest that chromosome congression defects as the result of KIF18A depletion is at least in part mediated through destabilizing kinetochore CENP-E.
19553660 Data show that the kinetochore localization of PinX1 is dependent on Hec1 and CENP-E.
19525938 Chromosome congression in HSET + hNuf2 co-depleted cells required the plus-end directed motor CENP-E , which has been implicated in the gliding of mono-oriented kinetochores alongside adjacent K-fibres.
18460473 SEPT7 forms a link between kinetochore distribution of CENP-E and the mitotic spindle checkpoint.
18374647 Global inhibition of SUMOylation caused a prometaphase arrest due to defects in targeting the microtubule motor protein CENP-E to kinetochores.
17535814 HsNUF2 and CENP-E are required for organization of stable microtubule-kinetochore attachment that is essential for faithful chromosome segregation in mitosis
17268814 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16926026 Results support a plus end motion for CENP-E, based on a cryoelectron microscopy density map of the complex to 17 A resolution, which is consistent with features of the crystallographic structure.
16144904 Microtubule capture by CENPE silences BubR1-dependent mitotic checkpoint signaling.
15236970 crystal structure reveals that the CENP-E linker region is in a "docked" position identical to that in the human plus-end directed conventional kinesin
15181147 Depletion of CENP-E leads to chromosomes missegregation and cell death during mitotic delay.
15159587 x-ray crystallographic analysis of the motor domain of human kinetochore-associated protein CENP-E using an automated crystallization procedure
12686615 MPS1 is required by cells to arrest in mitosis in response to spindle defects and kinetochore defects resulting from the loss of the kinesin-like protein.

AA Sequence

MAEEGAVAVCVRVRPLNSREESLGETAQVYWKTDNNVIYQVDGSKSFNFDRVFHGNETTKNVYEEIAAPI      1 - 70
IDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIFQKIKKFPDREFLLRVSYMEIYNETIT     71 - 140
DLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYTSEMALKWITKGEKSRHYGETKMNQRSSRSHTIFRMI    141 - 210
LESREKGEPSNCEGSVKVSHLNLVDLAGSERAAQTGAAGVRLKEGCNINRSLFILGQVIKKLSDGQVGGF    211 - 280
INYRDSKLTRILQNSLGGNAKTRIICTITPVSFDETLTALQFASTAKYMKNTPYVNEVSTDEALLKRYRK    281 - 350
EIMDLKKQLEEVSLETRAQAMEKDQLAQLLEEKDLLQKVQNEKIENLTRMLVTSSSLTLQQELKAKRKRR    351 - 420
VTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKL    421 - 490
LNQENIESELNSLRADYDNLVLDYEQLRTEKEEMELKLKEKNDLDEFEALERKTKKDQEMQLIHEISNLK    491 - 560
NLVKHAEVYNQDLENELSSKVELLREKEDQIKKLQEYIDSQKLENIKMDLSYSLESIEDPKQMKQTLFDA    561 - 630
ETVALDAKRESAFLRSENLELKEKMKELATTYKQMENDIQLYQSQLEAKKKMQVDLEKELQSAFNEITKL    631 - 700
TSLIDGKVPKDLLCNLELEGKITDLQKELNKEVEENEALREEVILLSELKSLPSEVERLRKEIQDKSEEL    701 - 770
HIITSEKDKLFSEVVHKESRVQGLLEEIGKTKDDLATTQSNYKSTDQEFQNFKTLHMDFEQKYKMVLEEN    771 - 840
ERMNQEIVNLSKEAQKFDSSLGALKTELSYKTQELQEKTREVQERLNEMEQLKEQLENRDSTLQTVEREK    841 - 910
TLITEKLQQTLEEVKTLTQEKDDLKQLQESLQIERDQLKSDIHDTVNMNIDTQEQLRNALESLKQHQETI    911 - 980
NTLKSKISEEVSRNLHMEENTGETKDEFQQKMVGIDKKQDLEAKNTQTLTADVKDNEIIEQQRKIFSLIQ    981 - 1050
EKNELQQMLESVIAEKEQLKTDLKENIEMTIENQEELRLLGDELKKQQEIVAQEKNHAIKKEGELSRTCD   1051 - 1120
RLAEVEEKLKEKSQQLQEKQQQLLNVQEEMSEMQKKINEIENLKNELKNKELTLEHMETERLELAQKLNE   1121 - 1190
NYEEVKSITKERKVLKELQKSFETERDHLRGYIREIEATGLQTKEELKIAHIHLKEHQETIDELRRSVSE   1191 - 1260
KTAQIINTQDLEKSHTKLQEEIPVLHEEQELLPNVKEVSETQETMNELELLTEQSTTKDSTTLARIEMER   1261 - 1330
LRLNEKFQESQEEIKSLTKERDNLKTIKEALEVKHDQLKEHIRETLAKIQESQSKQEQSLNMKEKDNETT   1331 - 1400
KIVSEMEQFKPKDSALLRIEIEMLGLSKRLQESHDEMKSVAKEKDDLQRLQEVLQSESDQLKENIKEIVA   1401 - 1470
KHLETEEELKVAHCCLKEQEETINELRVNLSEKETEISTIQKQLEAINDKLQNKIQEIYEKEEQFNIKQI   1471 - 1540
SEVQEKVNELKQFKEHRKAKDSALQSIESKMLELTNRLQESQEEIQIMIKEKEEMKRVQEALQIERDQLK   1541 - 1610
ENTKEIVAKMKESQEKEYQFLKMTAVNETQEKMCEIEHLKEQFETQKLNLENIETENIRLTQILHENLEE   1611 - 1680
MRSVTKERDDLRSVEETLKVERDQLKENLRETITRDLEKQEELKIVHMHLKEHQETIDKLRGIVSEKTNE   1681 - 1750
ISNMQKDLEHSNDALKAQDLKIQEELRIAHMHLKEQQETIDKLRGIVSEKTDKLSNMQKDLENSNAKLQE   1751 - 1820
KIQELKANEHQLITLKKDVNETQKKVSEMEQLKKQIKDQSLTLSKLEIENLNLAQKLHENLEEMKSVMKE   1821 - 1890
RDNLRRVEETLKLERDQLKESLQETKARDLEIQQELKTARMLSKEHKETVDKLREKISEKTIQISDIQKD   1891 - 1960
LDKSKDELQKKIQELQKKELQLLRVKEDVNMSHKKINEMEQLKKQFEAQNLSMQSVRMDNFQLTKKLHES   1961 - 2030
LEEIRIVAKERDELRRIKESLKMERDQFIATLREMIARDRQNHQVKPEKRLLSDGQQHLTESLREKCSRI   2031 - 2100
KELLKRYSEMDDHYECLNRLSLDLEKEIEFQKELSMRVKANLSLPYLQTKHIEKLFTANQRCSMEFHRIM   2101 - 2170
KKLKYVLSYVTKIKEEQHESINKFEMDFIDEVEKQKELLIKIQHLQQDCDVPSRELRDLKLNQNMDLHIE   2171 - 2240
EILKDFSESEFPSIKTEFQQVLSNRKEMTQFLEEWLNTRFDIEKLKNGIQKENDRICQVNNFFNNRIIAI   2241 - 2310
MNESTEFEERSATISKEWEQDLKSLKEKNEKLFKNYQTLKTSLASGAQVNPTTQDNKNPHVTSRATQLTT   2311 - 2380
EKIRELENSLHEAKESAMHKESKIIKMQKELEVTNDIIAKLQAKVHESNKCLEKTKETIQVLQDKVALGA   2381 - 2450
KPYKEEIEDLKMKLVKIDLEKMKNAKEFEKEISATKATVEYQKEVIRLLRENLRRSQQAQDTSVISEHTD   2451 - 2520
PQPSNKPLTCGGGSGIVQNTKALILKSEHIRLEKEISKLKQQNEQLIKQKNELLSNNQHLSNEVKTWKER   2521 - 2590
TLKREAHKQVTCENSPKSPKVTGTASKKKQITPSQCKERNLQDPVPKESPKSCFFDSRSKSLPSPHPVRY   2591 - 2660
FDNSSLGLCPEVQNAGAESVDSQPGPWHASSGKDVPECKTQ                                2661 - 2701
//

Text Mined References (68)

PMID Year Title
26321640 2015 CTCF Recruits Centromeric Protein CENP-E to the Pericentromeric/Centromeric Regions of Chromosomes through Unusual CTCF-Binding Sites.
25918224 2015 TRAMM/TrappC12 plays a role in chromosome congression, kinetochore stability, and CENP-E recruitment.
25908662 2015 Mitosis. Microtubule detyrosination guides chromosomes during mitosis.
25743205 2015 Chromokinesin Kid and kinetochore kinesin CENP-E differentially support chromosome congression without end-on attachment to microtubules.
25395579 2015 Chromosome congression is promoted by CENP-Q- and CENP-E-dependent pathways.
25383660 2014 Kinetochore motors drive congression of peripheral polar chromosomes by overcoming random arm-ejection forces.
24928852 2014 Chemogenetic evaluation of the mitotic kinesin CENP-E reveals a critical role in triple-negative breast cancer.
24920822 2014 Kinetochore-microtubule attachment throughout mitosis potentiated by the elongated stalk of the kinetochore kinesin CENP-E.
24748105 2014 Mutations in CENPE define a novel kinetochore-centromeric mechanism for microcephalic primordial dwarfism.
23955301 2013 Kinetochore kinesin CENP-E is a processive bi-directional tracker of dynamic microtubule tips.
23891108 2013 Lateral to end-on conversion of chromosome-microtubule attachment requires kinesins CENP-E and MCAK.
23740391 2013 Evolution driven structural changes in CENP-E motor domain.
23666240 2013 Identification of nine new susceptibility loci for testicular cancer, including variants near DAZL and PRDM14.
23236152 2012 Evolutionarily conserved protein ERH controls CENP-E mRNA splicing and is required for the survival of KRAS mutant cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22974711 Computational screening and molecular dynamics simulation of disease associated nsSNPs in CENP-E.
22801780 2012 CENP-E--dependent BubR1 autophosphorylation enhances chromosome alignment and the mitotic checkpoint.
22637578 2012 Microtubule capture by mitotic kinesin centromere protein E (CENP-E).
22307330 2012 CLASPs prevent irreversible multipolarity by ensuring spindle-pole resistance to traction forces during chromosome alignment.
22110139 2012 CENP-E kinesin interacts with SKAP protein to orchestrate accurate chromosome segregation in mitosis.
21269460 2011 Initial characterization of the human central proteome.
20691903 2010 Aurora kinases and protein phosphatase 1 mediate chromosome congression through regulation of CENP-E.
20354862 2010 Aurora B kinase cooperates with CENP-E to promote timely anaphase onset.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
20237434 2010 The interaction between mitotic checkpoint proteins, CENP-E and BubR1, is diminished in epothilone B-resistant A549 cells.
20021663 2009 Reduced expression of cenp-e in human hepatocellular carcinoma.
19946888 2010 Defining the membrane proteome of NK cells.
19733075 2009 Motor-independent targeting of CLASPs to kinetochores by CENP-E promotes microtubule turnover and poleward flux.
19723035 2009 Distribution of centromeric proteins and PARP-1 during mitosis and apoptosis.
19625775 2009 Defects in chromosome congression and mitotic progression in KIF18A-deficient cells are partly mediated through impaired functions of CENP-E.
19553660 2009 PinX1 is a novel microtubule-binding protein essential for accurate chromosome segregation.
19525938 2009 Chromosome congression in the absence of kinetochore fibres.
19465021 2009 A nucleolar protein RRS1 contributes to chromosome congression.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18460473 2008 Septin 7 interacts with centromere-associated protein E and is required for its kinetochore localization.
18374647 2008 SUMO-2/3 modification and binding regulate the association of CENP-E with kinetochores and progression through mitosis.
18342609 2008 Phosphorylation relieves autoinhibition of the kinetochore motor Cenp-E.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17535814 2007 Human NUF2 interacts with centromere-associated protein E and is essential for a stable spindle microtubule-kinetochore attachment.
17268814 2007 Genetic variation in the major mitotic checkpoint genes does not affect familial breast cancer risk.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16926026 2006 Human kinetochore-associated kinesin CENP-E visualized at 17 A resolution bound to microtubules.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16144904 2005 Microtubule capture by CENP-E silences BubR1-dependent mitotic checkpoint signaling.
15843429 2005 Functional analysis of human microtubule-based motor proteins, the kinesins and dyneins, in mitosis/cytokinesis using RNA interference.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15297875 2004 Essential roles of KIF4 and its binding partner PRC1 in organized central spindle midzone formation.
15236970 2004 Crystal structure of the motor domain of the human kinetochore protein CENP-E.
15181147 2004 Gene silencing of CENP-E by small interfering RNA in HeLa cells leads to missegregation of chromosomes after a mitotic delay.
15159587 2004 Crystallization and preliminary crystallographic analysis of the motor domain of human kinetochore-associated protein CENP-E using an automated crystallization procedure.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684825 2003 Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays.
12925705 2003 Centromere-associated protein-E is essential for the mammalian mitotic checkpoint to prevent aneuploidy due to single chromosome loss.
12686615 2003 Human MPS1 kinase is required for mitotic arrest induced by the loss of CENP-E from kinetochores.
11682612 2001 Specification of kinetochore-forming chromatin by the histone H3 variant CENP-A.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
11084331 2000 Survivin and the inner centromere protein INCENP show similar cell-cycle localization and gene knockout phenotype.
10852915 2000 Farnesyl transferase inhibitors block the farnesylation of CENP-E and CENP-F and alter the association of CENP-E with the microtubules.
10477750 1999 Human BUBR1 is a mitotic checkpoint kinase that monitors CENP-E functions at kinetochores and binds the cyclosome/APC.
9763420 1998 Characterization of the kinetochore binding domain of CENP-E reveals interactions with the kinetochore proteins CENP-F and hBUBR1.
9744883 1998 Active MAP kinase in mitosis: localization at kinetochores and association with the motor protein CENP-E.
9391217 1997 Localization of CENP-E in the fibrous corona and outer plate of mammalian kinetochores from prometaphase through anaphase.
9363944 1997 CENP-E is a plus end-directed kinetochore motor required for metaphase chromosome alignment.
7889940 1995 Mitotic HeLa cells contain a CENP-E-associated minus end-directed microtubule motor.
7851898 1994 Chromosomal localization of the genes encoding the kinetochore proteins CENPE and CENPF to human chromosomes 4q24-->q25 and 1q32-->q41, respectively, by fluorescence in situ hybridization.
2022189 1991 CENP-E, a novel human centromere-associated protein required for progression from metaphase to anaphase.
1406971 1992 CENP-E is a putative kinetochore motor that accumulates just before mitosis.