Property Summary

NCBI Gene PubMed Count 43
PubMed Score 44.98
PubTator Score 35.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 2.0

Expression

  Differential Expression (36)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.464 1.9e-03
psoriasis -1.100 8.1e-05
glioblastoma -1.700 4.9e-05
osteosarcoma -2.339 1.8e-02
cystic fibrosis 2.699 2.0e-07
atypical teratoid / rhabdoid tumor -2.100 7.0e-07
medulloblastoma -1.300 1.1e-04
medulloblastoma, large-cell -2.000 8.9e-05
primitive neuroectodermal tumor -1.400 6.7e-04
Duchenne muscular dystrophy 1.166 2.8e-06
autosomal dominant Emery-Dreifuss muscul... 1.231 3.3e-03
juvenile dermatomyositis 1.225 1.9e-10
Amyotrophic Lateral Sclerosis 1.348 2.5e-06
acute quadriplegic myopathy 1.719 2.1e-06
chronic kidney disease 1.200 4.2e-02
non-small cell lung cancer -2.230 3.3e-32
intraductal papillary-mucinous carcinoma... -2.300 8.8e-03
intraductal papillary-mucinous neoplasm ... -1.700 2.8e-02
lung cancer -1.400 5.7e-03
active Crohn's disease 1.338 4.3e-03
breast carcinoma -1.500 1.9e-04
fibroadenoma -1.700 1.1e-03
diabetes mellitus -1.200 1.1e-02
adult high grade glioma -1.500 2.0e-03
pilocytic astrocytoma -1.100 6.5e-04
posterior fossa group A ependymoma -1.200 1.2e-05
primary Sjogren syndrome 1.400 6.6e-04
lung adenocarcinoma -1.100 2.1e-09
lung carcinoma -3.000 1.3e-47
Breast cancer -2.200 1.5e-12
ductal carcinoma in situ -1.400 2.6e-03
invasive ductal carcinoma -2.000 1.9e-03
ulcerative colitis 1.300 1.5e-05
ovarian cancer -4.500 1.2e-14
pituitary cancer -2.300 5.1e-05
dermatomyositis 1.300 4.7e-04

Gene RIF (22)

PMID Text
26443849 a widespread role for the JNK-CELF2 axis in controlling splicing during T-cell activation, including a specific role in propagating JNK signaling.
26314850 the genetic variant rs3740194 in CELF2 gene might be a valuable predictor for NPC prognosis
26165303 Data show miR95 expression level positively related to glioma grade and its downregulation affects proliferation, invasion and apoptosis by targeting CELF2. MiR95 is identified as a putative therapeutic target and CELF2 as a potential tumor suppressor.
25870297 novel mechanisms for CELF2 regulation that may broadly impact CELF2 expression across diverse cell types.
25801238 The A allele of rs2242451 in CUGBP2 might decrease Alzheimer disease risk in the Chinese Han population.
21444716 Alternative splicing of LEF1 exon 6 is regulated during pre-TCR signaling in thymic development and in response to activation of the JSL1 T-cell line and this is driven by the activity of CELF2.
21439371 results indicate the occurrence of a mis-splicing event in myotonic dystrophy type 1 that is induced neither by a loss of muscleblind-like 1 (MBNL1) function nor by a gain of CUGBP1
21379329 There was evidence of association for recently-reported late-onset Alzheimer's disease risk loci, including BIN1 and CLU and CUGBP2 with APOE.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18325984 Data demonstrate that PGE(2) protects colon cancer cells from ionizing radiation-induced mitotic catastrophe in part through suppression of CUGBP2 expression.
18292181 Demonstrate that CUGBP2 inhibits Mcl-1 expression by inhibiting Mcl-1 mRNA translation, resulting in driving the cells to apoptosis during the G(2) phase of the cell cycle.
18258790 Data demonstrate that cells expressing CUGBP2 variant 1 undergo apoptosis during mitosis, suggesting mitotic catastrophe.
17383427 CUGBP2 overrides HuR and suppresses COX-2 mRNA translation.
16920700 Developmental upregulation of apoB mRNA editing from approximately 3% to 88% begins with decreased levels of inhibitory CUG binding protein 2 (CUGBP2) expression.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15358864 Lipopolysaccharide inhibition of CUGBP2 is a prostaglandin-dependent mechanism.
15033780 data suggest that CUGBP2 is a critical regulator of the apoptotic response to genotoxic injury in breast cancer cells
14973222 Determination of ETR-3 protein domains required for RNA splicing.
12110949 BRUNOL3 appears to be an important factor for thymus development and is therefore a candidate gene for the thymus hypoplasia/aplasia seen in partial monosomy 10p patients.

AA Sequence

MRCPKSAVTMRNEELLLSNGTANKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKELFEPYGAVYQIN      1 - 70
VLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVS     71 - 140
KKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFA    141 - 210
DTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGGLTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQL    211 - 280
QNLATLAAAAAAAQTSATSTNANPLSTTSSALGALTSPVAASTPNSTAGAAMNSLTSLGTLQGLAGATVG    281 - 350
LNNINALAGMAALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLLQQQSAAGSQKEGP    351 - 420
EGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIG    421 - 490
MKRLKVQLKRSKNDSKPY                                                        491 - 508
//

Text Mined References (53)

PMID Year Title
26443849 2015 Widespread JNK-dependent alternative splicing induces a positive feedback loop through CELF2-mediated regulation of MKK7 during T-cell activation.
26314850 2015 Association of CELF2 polymorphism and the prognosis of nasopharyngeal carcinoma in southern Chinese population.
26165303 2015 Downregulation of miR-95-3p inhibits proliferation, and invasion promoting apoptosis of glioma cells by targeting CELF2.
25870297 2015 Induced transcription and stability of CELF2 mRNA drives widespread alternative splicing during T-cell signaling.
25801238 2015 Genetic association of CUGBP2 and DNMBP with Alzheimer' s disease in the Chinese Han population.
24124411 2013 Genome-wide association study of liver enzymes in korean children.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21444716 2011 Signal- and development-dependent alternative splicing of LEF1 in T cells is controlled by CELF2.
21439371 2011 Mis-splicing of Tau exon 10 in myotonic dystrophy type 1 is reproduced by overexpression of CELF2 but not by MBNL1 silencing.
21379329 2011 Genome-wide association of familial late-onset Alzheimer's disease replicates BIN1 and CLU and nominates CUGBP2 in interaction with APOE.
21269460 2011 Initial characterization of the human central proteome.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
18325984 2008 CUGBP2 downregulation by prostaglandin E2 protects colon cancer cells from radiation-induced mitotic catastrophe.
18292181 2008 Translation inhibition during cell cycle arrest and apoptosis: Mcl-1 is a novel target for RNA binding protein CUGBP2.
18258790 2008 Novel intestinal splice variants of RNA-binding protein CUGBP2: isoform-specific effects on mitotic catastrophe.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17383427 2007 Functional antagonism between RNA binding proteins HuR and CUGBP2 determines the fate of COX-2 mRNA translation.
16920700 2007 ApoB mRNA editing is mediated by a coordinated modulation of multiple apoB mRNA editing enzyme components.
16862542 2006 ETR-3 represses Tau exons 2/3 inclusion, a splicing event abnormally enhanced in myotonic dystrophy type I.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15894795 2005 Identification of CELF splicing activation and repression domains in vivo.
15657417 2005 Identification of putative new splicing targets for ETR-3 using sequences identified by systematic evolution of ligands by exponential enrichment.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358864 2004 Dynamic antagonism between RNA-binding protein CUGBP2 and cyclooxygenase-2-mediated prostaglandin E2 in radiation damage.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15033780 2003 CUGBP2 plays a critical role in apoptosis of breast cancer cells in response to genotoxic injury.
14973222 2004 ETR-3 and CELF4 protein domains required for RNA binding and splicing activity in vivo.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12649496 2003 Antagonistic regulation of alpha-actinin alternative splicing by CELF proteins and polypyrimidine tract binding protein.
12535526 2003 Coupled mRNA stabilization and translational silencing of cyclooxygenase-2 by a novel RNA binding protein, CUGBP2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12110949 2002 Expression and mutation analysis of BRUNOL3, a candidate gene for heart and thymus developmental defects associated with partial monosomy 10p.
11931771 2002 Dynamic antagonism between ETR-3 and PTB regulates cell type-specific alternative splicing.
11577082 2001 Novel role for RNA-binding protein CUGBP2 in mammalian RNA editing. CUGBP2 modulates C to U editing of apolipoprotein B mRNA by interacting with apobec-1 and ACF, the apobec-1 complementation factor.
11414768 2001 Genomic organization and isoform-specific tissue expression of human NAPOR (CUGBP2) as a candidate gene for familial arrhythmogenic right ventricular dysplasia.
11158314 2001 The CELF family of RNA binding proteins is implicated in cell-specific and developmentally regulated alternative splicing.
10893231 2000 A family of human RNA-binding proteins related to the Drosophila Bruno translational regulator.
10524244 1999 Developmentally-regulated expression of mNapor encoding an apoptosis-induced ELAV-type RNA binding protein.
9887331 1999 Cardiac elav-type RNA-binding protein (ETR-3) binds to RNA CUG repeats expanded in myotonic dystrophy.
9858671 1998 Fluorescent differential display analysis of gene expression in apoptotic neuroblastoma cells.
8948631 1996 Identification of a (CUG)n triplet repeat RNA-binding protein and its expression in myotonic dystrophy.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7869393 1994 Single pass sequencing of a unidirectional human fetal heart cDNA library to discover novel genes of the cardiovascular system.