Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1.90
PubTator Score 18.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Hypertension 396 0.0 0.0
Disease Target Count
Hypertensive disease 292
Disease Target Count Z-score Confidence
Exocrine pancreatic insufficiency 32 3.411 1.7

Expression

Gene RIF (4)

AA Sequence

MIRTLLLSTLVAGALSCGDPTYPPYVTRVVGGEEARPNSWPWQVSLQYSSNGKWYHTCGGSLIANSWVLT      1 - 70
AAHCISSSRTYRVGLGRHNLYVAESGSLAVSVSKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQLA     71 - 140
CLPPAGTILPNNYPCYVTGWGRLQTNGAVPDVLQQGRLLVVDYATCSSSAWWGSSVKTSMICAGGDGVIS    141 - 210
SCNGDSGGPLNCQASDGRWQVHGIVSFGSRLGCNYYHKPSVFTRVSNYIDWINSVIANN               211 - 269
//

Text Mined References (19)

PMID Year Title