Property Summary

NCBI Gene PubMed Count 17
PubMed Score 247.96
PubTator Score 213.72

Knowledge Summary

Patent

No data available

Gene RIF (10)

PMID Text
26601880 Inverse association of HbA1c with faecal elastase 1 in people without diabetes suggests that pancreatic exocrine dysfunction might be an early disturbance that develops in parallel with hyperglycemia.
25319362 Results indicate that the extract of the mycelium of Tricholoma matsutake decreased elastase activity in a dose-dependent manner and reduced the levels of matrix metalloproteinase 1 (MMP-1).
24949484 Mutant genes (CELA1, HSPG2, and KCNK5) in Balkan endemic nephropathy patients encode proteins involved in basement membrane/extracellular matrix and vascular tone, tightly connected to process of angiogenesis.
24622077 Data indicate that fecal elastase-1 was lower in the pancreaticoduodenectomy (PD) group.
23395568 Fecal elastase-1 is useful to identify pancreatic insufficiency. Steatorrhea is anticipated in non-operated patients only when FE-1 is below the limit for a confident measurement of our assay
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20346360 Observational study of gene-disease association. (HuGE Navigator)
20174665 Screening in Jurkat T-cells with a short-hairpin-RNA (shRNA) library identifies elastase-1 (CELA1; serine protease) is important for HIV-1 replication
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCVDYQKT      1 - 70
FRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILA     71 - 140
NNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPL    141 - 210
HCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIASN                          211 - 258
//

Text Mined References (19)

PMID Year Title
26601880 Inverse association of HbA1c with faecal elastase 1 in people without diabetes.
25319362 2014 Extract of the mycelium of T. matsutake inhibits elastase activity and TPA-induced MMP-1 expression in human fibroblasts.
24949484 2014 NGS nominated CELA1, HSPG2, and KCNK5 as candidate genes for predisposition to Balkan endemic nephropathy.
24622077 2014 Nutritional status, fecal elastase-1, and 13C-labeled mixed triglyceride breath test in the long-term after pancreaticoduodenectomy.
23395568 Fecal elastase-1 is useful in the detection of steatorrhea in patients with pancreatic diseases but not after pancreatic resection.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10620133 2000 Human elastase 1: evidence for expression in the skin and the identification of a frequent frameshift polymorphism.
9175736 1997 Evolutionary silencing of the human elastase I gene (ELA1).
8575772 1995 Physical mapping of the human ELA1 gene between D12S361 and D12S347 on chromosome 12q13.
3648024 1987 Characterization of a silent gene for human pancreatic elastase I: structure of the 5'-flanking region.
1633328 1992 Genomic organization of the human homologue of the rat pancreatic elastase I gene.