Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.49
PubTator Score 11.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 1.3e-12
ulcerative colitis 2087 4.8e-05
colon cancer 1475 4.8e-03
nephrosclerosis 329 5.1e-03
active Crohn's disease 918 3.5e-02
Disease Target Count Z-score Confidence
Distal arthrogryposis 45 3.268 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
nephrosclerosis -1.247 5.1e-03
colon cancer -2.300 4.8e-03
active Crohn's disease -1.810 3.5e-02
ulcerative colitis -2.000 4.8e-05
psoriasis -1.200 1.3e-12

Gene RIF (9)

PMID Text
26463459 It suggests that methylation status of MUPCDH promoter can be used as a novel epigenetic biomarker and a therapeutic target in ADPKD.
24725409 Study found that brush border assembly is driven by the formation of Ca(2+)-dependent adhesion links between adjacent microvilli. Intermicrovillar links are composed of protocadherin-24 and mucin-like protocadherin, which target to microvillar tips and interact to form a trans-heterophilic complex.
22202456 The transcription factor Cdx2 activates expression of the protocadherin Mucdhl, which interacts with beta-catenin and regulates activities of colon cancer cells.
21839066 The MUPCDH genetic polymorphism rs3758650 was considered a genetic marker to predict symptomatic Gallstone disease subjects.
21315419 Our data consequently suggest that down-regulation of mu-protocadherin expression is a common event in colorectal carcinogenesis and might therefore play an important role in this pathologic process.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
12589428 MUCDHL genes are biallelically expressed in multiple fetal and adult tissues both in humans and in mice
12167596 identifed the human mu-protocadherin ortholog and examined its expression in the developing kidney

AA Sequence

MGSWALLWPPLLFTGLLVRPPGTMAQAQYCSVNKDIFEVEENTNVTEPLVDIHVPEGQEVTLGALSTPFA      1 - 70
FRIQGNQLFLNVTPDYEEKSLLEAQLLCQSGGTLVTQLRVFVSVLDVNDNAPEFPFKTKEIRVEEDTKVN     71 - 140
STVIPETQLQAEDRDKDDILFYTLQEMTAGASDYFSLVSVNRPALRLDRPLDFYERPNMTFWLLVRDTPG    141 - 210
ENVEPSHTATATLVLNVVPADLRPPWFLPCTFSDGYVCIQAQYHGAVPTGHILPSPLVLRPGPIYAEDGD    211 - 280
RGINQPIIYSIFRGNVNGTFIIHPDSGNLTVARSVPSPMTFLLLVKGQQADLARYSVTQVTVEAVAAAGS    281 - 350
PPRFPQRLYRGTVARGAGAGVVVKDAAAPSQPLRIQAQDPEFSDLNSAITYRITNHSHFRMEGEVVLTTT    351 - 420
TLAQAGAFYAEVEAHNTVTSGTATTVIEIQVSEQEPPSTDVPPSPEAGGTTGPWTSTTSEVPRPPEPSQG    421 - 490
PSTTSSGGGTGPHPPSGTTLRPPTSSTPGGPPGAENSTSHQPATPGGDTAQTPKPGTSQPMPPGVGTSTS    491 - 560
HQPATPSGGTAQTPEPGTSQPMPPSMGTSTSHQPATPGGGTAQTPEAGTSQPMPPGMGTSTSHQPTTPGG    561 - 630
GTAQTPEPGTSQPMPLSKSTPSSGGGPSEDKRFSVVDMAALGGVLGALLLLALLGLAVLVHKHYGPRLKC    631 - 700
CCGKAPEPQPQGFDNQAFLPDHKANWAPVPSPTHDPKPAEAPMPAEPAPPGPASPGGAPEPPAAARAGGS    701 - 770
PTAVRSILTKERRPEGGYKAVWFGEDIGTEADVVVLNAPTLDVDGASDSGSGDEGEGAGRGGGPYDAPGG    771 - 840
DDSYI                                                                     841 - 845
//

Text Mined References (23)

PMID Year Title
26812018 2016 ANKS4B Is Essential for Intermicrovillar Adhesion Complex Formation.
26463459 2015 Epigenetic silencing of the MUPCDH gene as a possible prognostic biomarker for cyst growth in ADPKD.
24725409 2014 Intestinal brush border assembly driven by protocadherin-based intermicrovillar adhesion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22202456 2012 Cdx2 controls expression of the protocadherin Mucdhl, an inhibitor of growth and ?-catenin activity in colon cancer cells.
21839066 2011 Polymorphism at the mucin-like protocadherin gene influences susceptibility to gallstone disease.
21315419 2011 Down-regulation of ?-protocadherin expression is a common event in colorectal carcinogenesis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12589428 2003 Biallelic expression of HRAS and MUCDHL in human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12167596 2002 Identification and expression analysis of the human mu-protocadherin gene in fetal and adult kidneys.
11031102 2000 Characterization of a 500-kb contig spanning the region between c-Ha-Ras and MUC2 on chromosome 11p15.5.
10817752 2000 Cadherin superfamily genes: functions, genomic organization, and neurologic diversity.
10801787 2000 mu-Protocadherin, a novel developmentally regulated protocadherin with mucin-like domains.