Property Summary

NCBI Gene PubMed Count 58
PubMed Score 139.86
PubTator Score 58.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.2e-04
dermatomyositis 966 2.0e-04
psoriasis 6694 3.6e-04
Multiple myeloma 1332 6.6e-04
Waldenstrons macroglobulinemia 765 1.5e-02
Breast cancer 3578 2.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cystoisosporiasis 5 4.49 2.2

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 2.600 2.9e-02
dermatomyositis 1.100 2.0e-04
Multiple myeloma 1.614 6.6e-04
osteosarcoma 3.166 1.2e-04
psoriasis 1.500 3.6e-04
Waldenstrons macroglobulinemia 1.030 1.5e-02

Gene RIF (20)

AA Sequence

MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEK      1 - 70
LLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPD     71 - 140
PIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDY    141 - 210
NAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAIL    211 - 280
QTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVAL    281 - 350
RTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGA    351 - 420
EGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDF    421 - 490
EIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLN    491 - 560
VEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELK    561 - 630
KAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINR    631 - 700
GHMTTEAKRAAKMEKKMKILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECL    701 - 770
KEDVQRQQEREKELQHRYADLLLEKETLKSKF                                          771 - 802
//

Text Mined References (71)

PMID Year Title