Property Summary

NCBI Gene PubMed Count 55
PubMed Score 130.64
PubTator Score 58.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 6.2e-06
osteosarcoma 7933 1.2e-04
dermatomyositis 966 2.0e-04
Multiple myeloma 1327 6.6e-04
Waldenstrons macroglobulinemia 764 1.5e-02
Breast cancer 3098 2.9e-02
Disease Target Count Z-score Confidence
Cystoisosporiasis 3 4.767 2.4

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.030 1.5e-02
Multiple myeloma 1.614 6.6e-04
psoriasis -4.200 6.2e-06
osteosarcoma 3.166 1.2e-04
Breast cancer 2.600 2.9e-02
dermatomyositis 1.100 2.0e-04

 GWAS Trait (1)

Gene RIF (18)

PMID Text
26553251 Cdc5L was highly expressed in hepatocellular carcinoma. Overexpression of Cdc5L favors cell cycle progress of HCC cells, while downregulation of Cdc5L results in cell cycle arrest at G2/M phase and reduced cell proliferation of HCC cells.
26130721 The results show that CTNNBL1 enhances the association of CWC15 and CDC5L, both core Prp19 complex proteins and identify an overlap in the region of CDC5L that binds either CTNNBL1 or CWC15 suggesting the two proteins might exchange places in the complex.
24675469 Cdc5L is a key regulator of mitotic progression.
24598747 The N-terminal ARM-repeat domain of CTNNBL1 provides a binding site for CDC5L, a binding partner in the Prp19-CDC5L complex.
23125841 Tandem affinity purification and mass spectrometry analysis identify CDC5 cell division cycle 5-like (CDC5L), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22944692 Tandem affinity purification and mass spectrometry analysis identify CDC5 cell division cycle 5-like (CDC5L), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22174317 Tandem affinity purification and mass spectrometry analysis identify CDC5 cell division cycle 5-like (CDC5L), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21385873 CTNNBL1 is a novel nuclear localization sequence-binding protein that recognizes RNA-splicing factors CDC5L and Prp31
21036905 Dbf4 regulates the Cdc5 Polo-like kinase through a distinct non-canonical binding interaction
20467437 A central region in hnRNP-M is required for interaction with CDC5L/PLRG1.
19641227 Blom7alpha is a novel splicing factor of the K homology domain family that might be implicated in alternative splicing by helping to position the CDC5L-SNEV(Prp19-Pso4) complex at the splice sites
19633697 These findings show a new function for Cdc5L in the regulation of the ATR-mediated cell-cycle checkpoint in response to genotoxic agents.
19240061 Observational study of gene-disease association. (HuGE Navigator)
18583928 Phosphorylation of CDC5L at threonines 411 and 438 within recognition sequences for CDKs are required for CDC5L-mediated pre-mRNA splicing.
18567798 Results indicate that CDC5L is the most likely candidate oncogene for the 6p12-p21 amplicon found in osteosarcoma.
18330920 Observational study of gene-disease association. (HuGE Navigator)
14576297 the interaction between CDC5L and PLRG1 is essential for pre-mRNA splicing
14515018 CDC5 may function in pre-mRNA processing and cell cycle progression

AA Sequence

MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEK      1 - 70
LLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPD     71 - 140
PIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKRKRGVDY    141 - 210
NAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAIL    211 - 280
QTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVAL    281 - 350
RTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGA    351 - 420
EGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDF    421 - 490
EIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLN    491 - 560
VEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELK    561 - 630
KAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINR    631 - 700
GHMTTEAKRAAKMEKKMKILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECL    701 - 770
KEDVQRQQEREKELQHRYADLLLEKETLKSKF                                          771 - 802
//

Text Mined References (67)

PMID Year Title
26553251 2016 Expression and Clinical Role of Cdc5L as a Novel Cell Cycle Protein in Hepatocellular Carcinoma.
26130721 2015 CTNNBL1 facilitates the association of CWC15 with CDC5L and is required to maintain the abundance of the Prp19 spliceosomal complex.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25064007 2014 A genome-wide association study identifies susceptibility loci for ossification of the posterior longitudinal ligament of the spine.
24675469 2014 Depletion of pre-mRNA splicing factor Cdc5L inhibits mitotic progression and triggers mitotic catastrophe.
24598747 2014 Structural insights into the novel ARM-repeat protein CTNNBL1 and its association with the hPrp19-CDC5L complex.
24332808 2014 PRP19 transforms into a sensor of RPA-ssDNA after DNA damage and drives ATR activation via a ubiquitin-mediated circuitry.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269683 2014 Structural and mutational analysis reveals that CTNNBL1 binds NLSs in a manner distinct from that of its closest armadillo-relative, karyopherin ?.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22941190 2012 Common variants at 6p21.1 are associated with large artery atherosclerotic stroke.
22763110 2012 Identification of new susceptibility loci for osteoarthritis (arcOGEN): a genome-wide association study.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21385873 2011 CTNNBL1 is a novel nuclear localization sequence-binding protein that recognizes RNA-splicing factors CDC5L and Prp31.
21269460 2011 Initial characterization of the human central proteome.
21036905 2010 Dbf4 regulates the Cdc5 Polo-like kinase through a distinct non-canonical binding interaction.
20467437 2010 Direct interaction between hnRNP-M and CDC5L/PLRG1 proteins affects alternative splice site choice.
20176811 2010 Molecular architecture of the human Prp19/CDC5L complex.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19641227 2009 Blom7alpha is a novel heterogeneous nuclear ribonucleoprotein K homology domain protein involved in pre-mRNA splicing that interacts with SNEVPrp19-Pso4.
19633697 2009 Cdc5L interacts with ATR and is required for the S-phase cell-cycle checkpoint.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18722174 2008 Interaction between antibody-diversification enzyme AID and spliceosome-associated factor CTNNBL1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18583928 2008 Cell cycle-dependent phosphorylation of human CDC5 regulates RNA processing.
18567798 2008 Cell cycle regulator gene CDC5L, a potential target for 6p12-p21 amplicon in osteosarcoma.
18330920 2008 Discovery of genetic profiles impacting response to chemotherapy: application to gemcitabine.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17332742 2007 Composition and three-dimensional EM structure of double affinity-purified, human prespliceosomal A complexes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17043677 2007 Disrupted in Schizophrenia 1 Interactome: evidence for the close connectivity of risk genes and a potential synaptic basis for schizophrenia.
16341674 2005 Transcriptome analysis of human gastric cancer.
16332694 2005 SNEV is an evolutionarily conserved splicing factor whose oligomerization is necessary for spliceosome assembly.
16216881 2005 Substrate specificity and activity regulation of protein kinase MELK.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15232106 2004 Self-assembling protein microarrays.
14729942 2004 Identification of phosphoproteins and their phosphorylation sites in the WEHI-231 B lymphoma cell line.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14576297 2003 Identification of peptide inhibitors of pre-mRNA splicing derived from the essential interaction domains of CDC5L and PLRG1.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14515018 2003 Distinct domains of human CDC5 direct its nuclear import and association with the spliceosome.
12927788 2003 hLodestar/HuF2 interacts with CDC5L and is involved in pre-mRNA splicing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11544257 2001 A direct interaction between the carboxyl-terminal region of CDC5L and the WD40 domain of PLRG1 is essential for pre-mRNA splicing.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11101529 2000 Functional analysis of the human CDC5L complex and identification of its components by mass spectrometry.
11082045 2000 Human Cdc5, a regulator of mitotic entry, can act as a site-specific DNA binding protein.
10827081 2000 NIPP1-mediated interaction of protein phosphatase-1 with CDC5L, a regulator of pre-mRNA splicing and mitotic entry.
10570151 1999 Evidence that Myb-related CDC5 proteins are required for pre-mRNA splicing.
9731529 1998 Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.
9632794 1998 Myb-related Schizosaccharomyces pombe cdc5p is structurally and functionally conserved in eukaryotes.
9598309 1998 Rearrangement of the human CDC5L gene by a t(6;19)(p21;q13.1) in a patient with multicystic renal dysplasia.
9468527 1998 A mammalian homolog of fission yeast Cdc5 regulates G2 progression and mitotic entry.
9455477 1997 Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro.
9038199 1997 Pombe Cdc5-related protein. A putative human transcription factor implicated in mitogen-activated signaling.
8917598 1996 A cdc5+ homolog of a higher plant, Arabidopsis thaliana.