Property Summary

NCBI Gene PubMed Count 7
PubMed Score 9.15
PubTator Score 4.60

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MPVLKQLGPAQPKKRPDRGALSISAPLGDFRHTLHVGRGGDAFGDTSFLSRHGGGPPPEPRAPPAGAPRS      1 - 70
PPPPAVPQSAAPSPADPLLSFHLDLGPSMLDAVLGVMDAARPEAAAAKPDAEPRPGTQPPQARCRPNADL     71 - 140
ELNDVIGL                                                                  141 - 148
//

Text Mined References (8)

PMID Year Title