Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.52
PubTator Score 3.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma 2.500 1.0e-02
oligodendroglioma 1.900 1.9e-03
psoriasis -2.200 4.5e-05
osteosarcoma -1.252 3.5e-02
astrocytoma 2.000 3.2e-02
glioblastoma 1.200 2.8e-04
medulloblastoma, large-cell -1.500 2.2e-02
adrenocortical carcinoma -1.028 8.7e-07
lung cancer -1.100 1.8e-03
invasive ductal carcinoma -1.791 1.5e-05
inflammatory breast cancer -1.100 8.3e-03

Gene RIF (1)

PMID Text
25981171 This study showed that CDC42EP4 messenger RNA levels was significantly upregulated in subjects with schizophrenia in laminar and cellular samples.

AA Sequence

MPILKQLVSSSVHSKRRSRADLTAEMISAPLGDFRHTMHVGRAGDAFGDTSFLNSKAGEPDGESLDEQPS      1 - 70
SSSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQLNEKEAAEKGTSKLPKSLS     71 - 140
SSPVKKANDGEGGDEEAGTEEAVPRRNGAAGPHSPDPLLDEQAFGDLTDLPVVPKATYGLKHAESIMSFH    141 - 210
IDLGPSMLGDVLSIMDKEEWDPEEGEGGYHGDEGAAGTITQAPPYAVAAPPLARQEGKAGPDLPSLPSHA    211 - 280
LEDEGWAAAAPSPGSARSMGSHTTRDSSSLSSCTSGILEERSPAFRGPDRARAAVSRQPDKEFSFMDEEE    281 - 350
EDEIRV                                                                    351 - 356
//

Text Mined References (24)

PMID Year Title
25981171 2015 Altered expression of CDC42 signaling pathway components in cortical layer 3 pyramidal cells in schizophrenia.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15226823 2004 Genomic analysis of mouse retinal development.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11185749 2000 Sequence analysis, gene expression, and chromosomal assignment of mouse Borg4 gene and its human orthologue.
11035016 2001 A new family of Cdc42 effector proteins, CEPs, function in fibroblast and epithelial cell shape changes.
10490598 1999 The Borgs, a new family of Cdc42 and TC10 GTPase-interacting proteins.