Property Summary

NCBI Gene PubMed Count 21
PubMed Score 4.56
PubTator Score 4.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1663 2.2e-03
Disease Target Count Z-score Confidence
Varicocele 21 3.629 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.200 2.2e-03

Synonym

Accession Q8NHZ8
Symbols APC12
ANAPC12
C9orf17

Gene

PDB

4UI9   5A31   5G04   5G05   5KHR   5L9U   5LCW   3HYM  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (5)

AA Sequence

MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQ      1 - 70
PKPNNRSSQFGSLEF                                                            71 - 85
//

Text Mined References (28)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19668213 2009 Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18485873 2008 Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16364912 2005 Localization of the coactivator Cdh1 and the cullin subunit Apc2 in a cryo-electron microscopy model of vertebrate APC/C.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14593737 2003 The mitotic checkpoint: a signaling pathway that allows a single unattached kinetochore to inhibit mitotic exit.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12070128 2002 Human securin proteolysis is controlled by the spindle checkpoint and reveals when the APC/C switches from activation by Cdc20 to Cdh1.
11742988 2001 APC/C-mediated destruction of the centrosomal kinase Nek2A occurs in early mitosis and depends upon a cyclin A-type D-box.
11535616 2001 Checkpoint inhibition of the APC/C in HeLa cells is mediated by a complex of BUBR1, BUB3, CDC20, and MAD2.
11340163 2001 A conserved cyclin-binding domain determines functional interplay between anaphase-promoting complex-Cdh1 and cyclin A-Cdk2 during cell cycle progression.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
10922056 2000 The RING-H2 finger protein APC11 and the E2 enzyme UBC4 are sufficient to ubiquitinate substrates of the anaphase-promoting complex.
10793135 2000 Mitotic regulation of the APC activator proteins CDC20 and CDH1.
10548110 1999 Accumulation of cyclin B1 requires E2F and cyclin-A-dependent rearrangement of the anaphase-promoting complex.
8895471 1996 Identification of subunits of the anaphase-promoting complex of Saccharomyces cerevisiae.