Property Summary

NCBI Gene PubMed Count 22
PubMed Score 4.56
PubTator Score 4.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 2.2e-03
Disease Target Count Z-score Confidence
Varicocele 26 3.612 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.200 2.2e-03

PDB (10)

AA Sequence

MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQ      1 - 70
PKPNNRSSQFGSLEF                                                            71 - 85
//

Text Mined References (28)

PMID Year Title