Property Summary

NCBI Gene PubMed Count 22
PubMed Score 4.56
PubTator Score 4.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 2.2e-03
Disease Target Count Z-score Confidence
Varicocele 26 3.612 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.200 2.2e-03

Synonym

Accession Q8NHZ8
Symbols APC12
ANAPC12
C9orf17

Gene

PDB

4UI9   5A31   5G04   5G05   5KHR   5KHU   5L9T   5L9U   5LCW   3HYM  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQ      1 - 70
PKPNNRSSQFGSLEF                                                            71 - 85
//

Text Mined References (28)

PMID Year Title