Property Summary

NCBI Gene PubMed Count 130
PubMed Score 295.28
PubTator Score 477.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 2.300 1.1e-06
glioblastoma 1.200 1.0e-05
group 3 medulloblastoma 2.800 1.5e-07
atypical teratoid/rhabdoid tumor 1.600 3.1e-09
medulloblastoma, large-cell 1.600 1.3e-04
primitive neuroectodermal tumor 1.500 1.1e-03
adrenocortical carcinoma 1.378 1.4e-03
non-small cell lung cancer 1.248 2.4e-18
intraductal papillary-mucinous neoplasm ... 1.500 9.2e-04
lung cancer 1.800 1.4e-03
pediatric high grade glioma 1.200 1.0e-04
lung adenocarcinoma 1.300 3.0e-10
Endometriosis 1.030 1.8e-02
Breast cancer 1.800 1.1e-14
ovarian cancer 1.300 1.1e-06
psoriasis 1.500 9.1e-70

 GWAS Trait (1)

Gene RIF (92)

PMID Text
26805039 These miR-142-3p functioned as a tumor suppressor by targeting CDC25C.
26595675 Suggest that the p53-p21-DREAM-CDE/CHR pathway regulates p53-dependent repression of Survivin, CDC25C, and PLK1 in HCT116 cells.
26474275 Data indicate that nine compounds were identified with Ki values for CDC25A, -B and -C ranging from 0.01 to 4.4 muM.
25633196 Cdc25C negatively regulates proapoptotic ASK1 in a cell cycle-dependent manner and may play a role in G2/M checkpoint-mediated apoptosis.
25397735 CDC25C seems important for the phenotype of AML cells at least for a subset of patients. Many of the identified CDC25 inhibitors show cross-reactivity among the three CDC25 isoforms.
25340978 for the first time, we demonstrated that CTD induced G2/M phase arrest via the inhibition of Cdc25c and cyclin A and induced apoptosis was through death receptor (extrinsic), intrinsic (mitochondria) and ER stress pathways in A375. S2 cells.
25159113 Recurrent CDC25C mutations drive malignant transformation in familial platelet disorder to acute myelogenous leukaemia.
24626146 we conclude that inhibition of KIF22 suppresses cancer cell proliferation by delaying mitotic exit through the transcriptional upregulation of CDC25C.
24158819 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
24032677 calmodulin is a regulatory molecule that associates with Plk1 from G2 to metaphase resulting in considerable stimulation of Plk1 kinase activity leading to hyperphosphorylation of Cdc25C.
24002546 These findings indicate that DHM inhibits the growth of hepatocellular carcinoma (HCC) cells via G2/M phase cell cycle arrest through Chk1/Chk2/Cdc25C pathway
23637932 protein plays a role in regulating PCa cell growth, and androgen treatments, but not EGF, greatly increase Cdc25C protein levels in AS PCa cells, which is in part by decreasing its degradation.
23600770 Through the ATR-Chk1-Cdc25C and Weel pathways were the central mechanisms for G2 /M phase arrest in human colon cancer cells.
23567337 Purification and biochemical analysis of catalytically active human cdc25C dual specificity phosphatase
22843362 dose-dependent Cdc25c phosphatase acts as an early G2-phase checkpoint, thus indicating mechanistic importance in the low-dose hyper-radiosensitivity and induced radioresistance transition
22842784 Dysfunctional telomeres promote ATM/ATR-dependent degradation of CDC25C phosphatase to block mitotic entry, thereby preventing telomere dysfunction-driven genomic instability.
22394631 cloning and functional analysis of Cdc25C
22360685 data suggest that the maintenance of CDC25 activity does not fully rely on the thioredoxin reductase system in breast cancer cells, even in the presence of a major oxidative stress
22021033 MMEQ induced G2/M arrest through the promotion of cdc25c in TSGH8301 cells.
21750987 Inhibition of CK2 activity by three different inhibitors led to a down-regulation of the level of cdc25C.
21379580 Cdc14B-dependent modulation of Cdc25 phosphatase and Cdk1/cyclin B activity is linked to correct chromosome segregation and bipolar spindle formation, processes that are required for proper progression through mitosis and maintenance of genomic stability.
21318276 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
21189416 Two additional sites other than Ser216 in the widely studied cell division cycle (Cdc) protein 25C, whose function depends on 14-3-3 binding, were identified.
20668692 The results show for the first time that in human mitosis, distinct phospho-isoforms of cdc25C exist with different localizations and interacting partners.
20514472 ATM and Chk1/2 mediated phosphorylation of cdc25c plays a major role in cell cycle arrest induced by pectenotoxin2.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20500813 CDC25C and phospho-CDC25C (Ser216) play a crucial role in the pathogenesis and/or progression of vulvar squamous cell carcinomas.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20360007 Cdc25 phosphatases are required for timely assembly of CDK1-cyclin B at the G2/M transition
20025242 Adventitious arsenate reductase activity of the catalytic domain of the human and Cdc25C phosphatases
20012529 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
19692168 Observational study of gene-disease association. (HuGE Navigator)
19626602 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19473963 ectopic expression of PFKFB3 increased the expression of several key cell cycle proteins, including cyclin-dependent kinase (Cdk)-1, Cdc25C, and cyclin D3 and decreased the expression of the cell cycle inhibitor p27
19458171 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
19275588 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
19275586 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19074854 Cdc25C has a role in sensitivity of tumor cells to doxorubicin-induced cell death
18838868 Downregulation of the phosphatase CDC25A could solely be responsible for the slow growth phenotype in MCF10A/Bcl-2 cells.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18604163 study reports that a fraction of Cdc25C localises to centrosomes in a cell cycle-dependent fashion, as of late S phase and throughout G2 and mitosis; data suggest an unexpected function for Cdc25C at the G2/M transition, in dephosphorylation of Cdk1
18551998 The expression of CDC25A, CDC25B and the proliferation marker Ki-67 are not associated with prognosis in LSCC
18464119 Five novel splicing isoforms were detected, and the splicing patterns were generally distinct in neoplastic samples compared with healthy controls.
18445273 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
18384749 First-time evidence was provided for the existence of multiple species of Cdc25C in mitotic cell extracts.
18371353 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
18272575 cdc25C phosphatase plays a role in viral replication and that this role extends beyond its function of activating cdc2 for initiation of the ICP22-dependent cascade for upregulation of gamma(2) gene expression.
18272572 both U(L)13 and U(S)3 viral kinases phosphorylate cdc25C and ICP22; however, in infected cells, the ability of cdc25C to activate cdc2 by dephosphorylation of the inactive cdc2 protein is reduced
18161793 Cdc25C is a dual specificity phosphatase essential for dephosphorylation and activation of cyclin-dependent kinase is a prerequisite step for mitosis in all eucaryotes. Cdc25C activation requires phosphorylation.
18160429 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
18056802 PP2A:B56delta as a key upstream regulator of Cdk1 activity upon exit from mitosis
17611691 p53 like other binding partners of cdc25C, regulates entry into mitosis by binding to cdc25C
17591782 Cdc25B, but not Cdc25C, is capable of inhibiting cellular proliferation in a manner dependent upon its catalytic activity
17548228 Cdc25C is located in the cytoplasm at defined dense structures, which according to immunofluorescence analysis, electron microscopy as well as biochemical subfractionation, are proven to be the centrosomes.
17419986 Partial or complete loss of Lzts1 downregulates Cdc25C and inhibits Cdk1 activity during mitosis, leading to premature transition from metaphase to anaphase.
17382881 In A2780 cells, ERK1/2 interacts with Cdc25C in interphase and phosphorylates Cdc25C in mitosis. Inhibition of ERK activation partially inhibits T48 phosphorylation, Cdc25C activation, and mitotic induction.
17349584 In Lzts1(-/-) mouse embryo fibroblasts (MEFs), Cdc25C degradation was increased during M phase, resulting in decreased Cdk1 activity.
17097061 cdc25C is located in the cytoplasm at defined dense structures which by immunofluorescence analysis as well as by biochemical subfractionation turned out to be the Golgi apparatus.
16807237 DNA damage-induced down-regulation of human Cdc25C
16751065 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
16649252 Chk1-mediated phosphorylation of Cdc25C plays a major role in response to LOR-mediated G(2)/M arrest. Although the Chk1-mediated cell growth arrest in a tumor cell line.
16648550 Phosphorylation of cdc25c can be used to test whether a pharmacologic inhibitor of Plk1 would exert the same cellular effects as interference with Plk1 on an mRNA level.
16582626 These results demonstrate that the MAPK ERK signaling pathway contributes to the p53-independent antiproliferative functions of p14ARF. Furthermore, they identify a new mechanism by which phosphorylation at serine 216 participates to Cdc25C inactivation.
16582488 Crystallization experiments of PLK1 protein in complex with an unphosphorylated and a phosphorylated target peptide from Cdc25C yield crystals suitable for X-ray diffraction analysis.
16356754 Data suggest that Pim-1 activates Cdc25C by a direct phosphorylation and can thereby assume the function of a positive cell cycle regulator at the G2/M transition.
16000564 Data suggests that CDC25C might play an important role in prostate cancer progression and could be used to monitor and predict the aggressiveness of this disease.
15887239 Vitamin C transiently arrests cancer cell cycle progression in S phase and G2/M boundary by modulating the kinetics of activation of CDC25C.
15708996 Vpr promotes cell cycle arrest at the G(2)/M phase by facilitating association of 14-3-3 and Cdc25C
15708996 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
15638722 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
15574328 downregulation of Cdc25C is mediated by p53 via two independent mechanisms, one involving direct binding to the cdc25C promoter
15265780 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
15142382 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
14972559 binding to VPR protein in human cell lines correlates with G2 arrest
14972559 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
14968113 CDC25C translocation to the cell nucleus upon entry into mitosis is coordinated by Plk3
12857880 cdc25C not only plays a role at the G2/M transition but also in the modulation of DNA replication
12766774 CDC25C is phosphorylated on Ser 214 during mitosis which, in turn, prevents phosphorylation of Ser 216. HeLa cells depeleted of endogenous CDC25C, when treated with exogenous CDC25C, had a substantial delay to mitotic entry.
12386164 phosphorylation by Chk2
12175337 Ca2+ promotes erythrocyte band 3 tyrosine phosphorylation via dissociation of phosphotyrosine phosphatase from band 3.
12099692 Human CDC25B and CDC25C differ by their ability to restore a functional checkpoint response after gene replacement in fission yeast
11925443 role of degradation by oxidative stress in induction of cell cycle arrest
11897663 results suggest that Plk1 phosphorylates Cdc25C on Ser198 and regulates nuclear translocation of Cdc25C during prophase
11842186 Analysis of cell cycle profile and cell cycle regulatory proteins indicated that arsenite arrested cell cycle at G(2)/M phase, partially through induction of cell division cycle 25 (Cdc25) isoform C (Cdc25C) degradation via ubiquitin-proteasome pathways
11691994 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
11531413 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
9520381 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
7494303 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
7474100 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25

AA Sequence

MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKR      1 - 70
CLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRK     71 - 140
RDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSG    141 - 210
LYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQG    211 - 280
HLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQ    281 - 350
EELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF    351 - 420
PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP                     421 - 473
//

Text Mined References (135)

PMID Year Title
26805039 2016 miR-142-3p inhibits cancer cell proliferation by targeting CDC25C.
26595675 2015 Indirect p53-dependent transcriptional repression of Survivin, CDC25C, and PLK1 genes requires the cyclin-dependent kinase inhibitor p21/CDKN1A and CDE/CHR promoter sites binding the DREAM complex.
26474275 2015 Ligand-based chemoinformatic discovery of a novel small molecule inhibitor targeting CDC25 dual specificity phosphatases and displaying in vitro efficacy against melanoma cells.
25633196 2015 Cell cycle-dependent Cdc25C phosphatase determines cell survival by regulating apoptosis signal-regulating kinase 1.
25397735 2014 Therapeutic targeting the cell division cycle 25 (CDC25) phosphatases in human acute myeloid leukemia--the possibility to target several kinases through inhibition of the various CDC25 isoforms.
25340978 2014 Cantharidin induces G2/M phase arrest by inhibition of Cdc25c and Cyclin A and triggers apoptosis through reactive oxygen species and the mitochondria?dependent pathways of A375.S2 human melanoma cells.
25159113 2014 Recurrent CDC25C mutations drive malignant transformation in FPD/AML.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24626146 2014 Inhibition of KIF22 suppresses cancer cell proliferation by delaying mitotic exit through upregulating CDC25C expression.
24032677 2013 Calmodulin activation of polo-like kinase 1 is required during mitotic entry.
24002546 2013 Dihydromyricetin suppresses the proliferation of hepatocellular carcinoma cells by inducing G2/M arrest through the Chk1/Chk2/Cdc25C pathway.
23637932 2013 Androgens upregulate Cdc25C protein by inhibiting its proteasomal and lysosomal degradation pathways.
23600770 2013 HY-1 induces G(2)/M cell cycle arrest in human colon cancer cells through the ATR-Chk1-Cdc25C and Weel pathways.
23567337 2013 Purification and biochemical analysis of catalytically active human cdc25C dual specificity phosphatase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22843362 2012 Cell division cycle 25 homolog c effects on low-dose hyper-radiosensitivity and induced radioresistance at elevated dosage in A549 cells.
22842784 2012 ATM/ATR checkpoint activation downregulates CDC25C to prevent mitotic entry with uncapped telomeres.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22394631 2012 [Prokaryotic expression and purification of human GST-Cdc25C fusion protein and preliminary detection of its function].
22360685 2012 Protection of CDC25 phosphatases against oxidative stress in breast cancer cells: evaluation of the implication of the thioredoxin system.
22021033 2012 A novel synthetic 2-(3-methoxyphenyl)-6,7-methylenedioxoquinolin-4-one arrests the G2/M phase arrest via Cdc25c and induces apoptosis through caspase- and mitochondria-dependent pathways in TSGH8301 human bladder cancer cells.
21750987 2011 Down-regulation of CK2 activity results in a decrease in the level of cdc25C phosphatase in different prostate cancer cell lines.
21379580 2011 Human Cdc14B promotes progression through mitosis by dephosphorylating Cdc25 and regulating Cdk1/cyclin B activity.
21189416 2011 A robust protocol to map binding sites of the 14-3-3 interactome: Cdc25C requires phosphorylation of both S216 and S263 to bind 14-3-3.
20668692 2010 Distinct pools of cdc25C are phosphorylated on specific TP sites and differentially localized in human mitotic cells.
20514472 2010 Pectenotoxin-2 induces G2/M phase cell cycle arrest in human breast cancer cells via ATM and Chk1/2-mediated phosphorylation of cdc25C.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20500813 2010 Overexpression of CDC25B, CDC25C and phospho-CDC25C (Ser216) in vulvar squamous cell carcinomas are associated with malignant features and aggressive cancer phenotypes.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20360007 2010 Cdc25 phosphatases are required for timely assembly of CDK1-cyclin B at the G2/M transition.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20025242 2010 Adventitious arsenate reductase activity of the catalytic domain of the human Cdc25B and Cdc25C phosphatases.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19626602 2010 Elevated lung cancer risk is associated with deficiencies in cell cycle checkpoints: genotype and phenotype analyses from a case-control study.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19473963 2009 Nuclear targeting of 6-phosphofructo-2-kinase (PFKFB3) increases proliferation via cyclin-dependent kinases.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19074854 2008 Overexpression of the dual specificity phosphatase, Cdc25C, confers sensitivity on tumor cells to doxorubicin-induced cell death.
18838868 2008 Microarray and pathway analysis reveals decreased CDC25A and increased CDC42 associated with slow growth of BCL2 overexpressing immortalized breast cell line.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18604163 2008 Characterization of centrosomal localization and dynamics of Cdc25C phosphatase in mitosis.
18551998 2007 [Prognostic value of CDC25 phosphatases expression in laryngeal cancer].
18464119 2008 Aberrant pre-mRNA splicing of a highly conserved cell cycle regulator, CDC25C, in myelodysplastic syndromes.
18384749 2008 Differential phosphorylation of Cdc25C phosphatase in mitosis.
18272575 2008 Role of cellular phosphatase cdc25C in herpes simplex virus 1 replication.
18272572 2008 The interaction of herpes simplex virus 1 regulatory protein ICP22 with the cdc25C phosphatase is enabled in vitro by viral protein kinases US3 and UL13.
18239451 2008 Human Plk4 phosphorylates Cdc25C.
18161793 2008 The cell cycle control protein cdc25C is present, and phosphorylated on serine 214 in the transition from germinal vesicle to metaphase II in human oocyte meiosis.
18056802 2007 Control of mitotic exit by PP2A regulation of Cdc25C and Cdk1.
17611691 2007 Interference between p53 and cdc25C in cell cycle regulation.
17591782 2007 The dual specificity phosphatase Cdc25B, but not the closely related Cdc25C, is capable of inhibiting cellular proliferation in a manner dependent upon its catalytic activity.
17548228 2007 The G2/M checkpoint phosphatase cdc25C is located within centrosomes.
17419986 2007 Timing is everything: regulation of Cdk1 and aneuploidy.
17382881 2007 Regulation of Cdc25C by ERK-MAP kinases during the G2/M transition.
17349584 2007 Fez1/Lzts1 absence impairs Cdk1/Cdc25C interaction during mitosis and predisposes mice to cancer development.
17110335 2006 Role for the PP2A/B56delta phosphatase in regulating 14-3-3 release from Cdc25 to control mitosis.
17097061 2006 The mitotic phosphatase cdc25C at the Golgi apparatus.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16807237 2006 DNA damage-induced down-regulation of human Cdc25C and Cdc2 is mediated by cooperation between p53 and maintenance DNA (cytosine-5) methyltransferase 1.
16649252 2006 Checkpoint kinase 1-mediated phosphorylation of Cdc25C and bad proteins are involved in antitumor effects of loratadine-induced G2/M phase cell-cycle arrest and apoptosis.
16648550 2006 Molecular alterations after Polo-like kinase 1 mRNA suppression versus pharmacologic inhibition in cancer cells.
16582626 2006 p14ARF triggers G2 arrest through ERK-mediated Cdc25C phosphorylation, ubiquitination and proteasomal degradation.
16582488 2006 Crystallization and preliminary X-ray diffraction studies on the human Plk1 Polo-box domain in complex with an unphosphorylated and a phosphorylated target peptide from Cdc25C.
16356754 2006 The oncogenic serine/threonine kinase Pim-1 directly phosphorylates and activates the G2/M specific phosphatase Cdc25C.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16330544 2006 Chaperoning checkpoint kinase 1 (Chk1), an Hsp90 client, with purified chaperones.
16000564 2005 Increased expression and activity of CDC25C phosphatase and an alternatively spliced variant in prostate cancer.
15887239 2005 Vitamin C transiently arrests cancer cell cycle progression in S phase and G2/M boundary by modulating the kinetics of activation and the subcellular localization of Cdc25C phosphatase.
15791647 2005 Involvement of protein kinase PKN1 in G2/M delay caused by arsenite.
15708996 2005 Vpr protein of human immunodeficiency virus type 1 binds to 14-3-3 proteins and facilitates complex formation with Cdc25C: implications for cell cycle arrest.
15629715 2005 MAPKAP kinase-2 is a cell cycle checkpoint kinase that regulates the G2/M transition and S phase progression in response to UV irradiation.
15574328 2004 DNA damage-induced downregulation of Cdc25C is mediated by p53 via two independent mechanisms: one involves direct binding to the cdc25C promoter.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15150265 2004 Human SAD1 kinase is involved in UV-induced DNA damage checkpoint function.
14972559 2004 The human immunodeficiency virus Vpr protein binds Cdc25C: implications for G2 arrest.
14968113 2004 Cdc25C phosphorylation on serine 191 by Plk3 promotes its nuclear translocation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14532005 2003 The molecular basis for phosphodependent substrate targeting and regulation of Plks by the Polo-box domain.
12941695 2003 Functional analysis of C-TAK1 substrate binding and identification of PKP2 as a new C-TAK1 substrate.
12937170 2003 DNA damage-induced G2/M checkpoint in SV40 large T antigen-immortalized embryonic fibroblast cells requires SHP-2 tyrosine phosphatase.
12857880 2003 Functional cdc25C dual-specificity phosphatase is required for S-phase entry in human cells.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12766774 2003 Dual phosphorylation controls Cdc25 phosphatases and mitotic entry.
12595692 2003 Proteomic screen finds pSer/pThr-binding domain localizing Plk1 to mitotic substrates.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12386164 2002 Checkpoint kinase 2 (Chk2) monomers or dimers phosphorylate Cdc25C after DNA damage regardless of threonine 68 phosphorylation.
12175337 2002 Ca2+ promotes erythrocyte band 3 tyrosine phosphorylation via dissociation of phosphotyrosine phosphatase from band 3.
11933156 2002 Cdc25C expression in meiotically competent and incompetent goat oocytes.
11897663 2002 Plk1 promotes nuclear translocation of human Cdc25C during prophase.
11896603 2002 Cdc25C interacts with PCNA at G2/M transition.
11836499 2002 BRCA1 regulates the G2/M checkpoint by activating Chk1 kinase upon DNA damage.
11691994 2001 Dynamic disruptions in nuclear envelope architecture and integrity induced by HIV-1 Vpr.
11551930 2001 Plk3 functionally links DNA damage to cell cycle arrest and apoptosis at least in part via the p53 pathway.
11531413 2001 HIV-1 Vpr induces cell cycle G2 arrest in fission yeast (Schizosaccharomyces pombe) through a pathway involving regulatory and catalytic subunits of PP2A and acting on both Wee1 and Cdc25.
11389730 2001 Differential actions of p60c-Src and Lck kinases on the Ras regulators p120-GAP and GDP/GTP exchange factor CDC25Mm.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
11333986 2001 Initiation of a G2/M checkpoint after ultraviolet radiation requires p38 kinase.
11304565 2001 Differential expression of cdc25 cell-cycle-activating phosphatases in human colorectal carcinoma.
11202906 2000 The human polo-like kinase, PLK, regulates cdc2/cyclin B through phosphorylation and activation of the cdc25C phosphatase.
11139144 2000 Alternative splicing in the regulatory region of the human phosphatases CDC25A and CDC25C.
11078813 2000 An additional transcript of the cdc25C gene from A431 cells encodes a functional protein.
11063929 2000 Control of mitosis by changes in the subcellular location of cyclin-B1-Cdk1 and Cdc25C.
10864927 2000 An essential phosphorylation-site domain of human cdc25C interacts with both 14-3-3 and cyclins.
10853038 2000 Binding of the growth suppressor p53 protein to the cell cycle regulator phosphatase cdc25C.
10744722 2000 Caffeine abolishes the mammalian G(2)/M DNA damage checkpoint by inhibiting ataxia-telangiectasia-mutated kinase activity.
10740819 2000 Cell cycle regulation by the Cdc25 phosphatase family.
10681541 2000 The Chk1 protein kinase and the Cdc25C regulatory pathways are targets of the anticancer agent UCN-01.
10557092 1999 The physical association and phosphorylation of Cdc25C protein phosphatase by Prk.
10330186 1999 Cytoplasmic localization of human cdc25C during interphase requires an intact 14-3-3 binding site.
10037602 1999 Function of WW domains as phosphoserine- or phosphothreonine-binding modules.
9923681 1999 Nuclear localization of Cdc25 is regulated by DNA damage and a 14-3-3 protein.
9733650 1998 A model of Cdc25 phosphatase catalytic domain and Cdk-interaction surface based on the presence of a rhodanese homology domain.
9585407 1998 Nuclear localization of cyclin B1 controls mitotic entry after DNA damage.
9520381 1998 HIV-1 Vpr interacts with a human 34-kDa mov34 homologue, a cellular factor linked to the G2/M phase transition of the mammalian cell cycle.
9499405 1998 The essential mitotic peptidyl-prolyl isomerase Pin1 binds and regulates mitosis-specific phosphoproteins.
9482729 1998 The mitotic peptidyl-prolyl isomerase, Pin1, interacts with Cdc25 and Plx1.
9278512 1997 Mitotic and G2 checkpoint control: regulation of 14-3-3 protein binding by phosphorylation of Cdc25C on serine-216.
9278511 1997 Conservation of the Chk1 checkpoint pathway in mammals: linkage of DNA damage to Cdk regulation through Cdc25.
9268380 1997 Human Myt1 is a cell cycle-regulated kinase that inhibits Cdc2 but not Cdk2 activity.
9141461 1997 Cdc25 protein phosphatases in cell proliferation.
8440392 1993 Dephosphorylation of human p34cdc2 kinase on both Thr-14 and Tyr-15 by human cdc25B phosphatase.
8432534 1993 Localization of human cell cycle regulatory genes CDC25C to 5q31 and WEE1 to 11p15.3-11p15.1 by fluorescence in situ hybridization.
8402895 1993 Functional analysis of the P box, a domain in cyclin B required for the activation of Cdc25.
8119945 1994 Activation of p34cdc2 protein kinase by microinjection of human cdc25C into mammalian cells. Requirement for prior phosphorylation of cdc25C by p34cdc2 on sites phosphorylated at mitosis.
7494303 1995 Mutational analysis of cell cycle arrest, nuclear localization and virion packaging of human immunodeficiency virus type 1 Vpr.
7479023 1995 Cell cycle regulation of cdc25C transcription is mediated by the periodic repression of the glutamine-rich activators NF-Y and Sp1.
7474100 1995 Human immunodeficiency virus type 1 Vpr arrests the cell cycle in G2 by inhibiting the activation of p34cdc2-cyclin B.
2195549 1990 Human homolog of fission yeast cdc25 mitotic inducer is predominantly expressed in G2.
1836978 1991 Specific activation of cdc25 tyrosine phosphatases by B-type cyclins: evidence for multiple roles of mitotic cyclins.
1828290 1991 Dephosphorylation and activation of a p34cdc2/cyclin B complex in vitro by human CDC25 protein.
1703321 1990 Complementation of the mitotic activator, p80cdc25, by a human protein-tyrosine phosphatase.
1386342 1992 Assignment of two human cell cycle genes, CDC25C and CCNB1, to 5q31 and 5q12, respectively.