Property Summary

NCBI Gene PubMed Count 42
PubMed Score 51.47
PubTator Score 26.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
colon cancer 2.800 3.3e-02
osteosarcoma -1.278 1.8e-05
ovarian cancer -1.900 7.1e-07
Pick disease -1.200 2.3e-04
primary pancreatic ductal adenocarcinoma -1.088 3.8e-03
sonic hedgehog group medulloblastoma 1.200 6.2e-06
Waldenstrons macroglobulinemia 1.014 2.0e-03

 GWAS Trait (1)

PDB (10)

Gene RIF (5)

AA Sequence

MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYE      1 - 70
ACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIY     71 - 140
DALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLK    141 - 210
KYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNK    211 - 280
ANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEH    281 - 350
DQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKT    351 - 420
AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHS    421 - 490
LMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIIS    491 - 560
PPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST              561 - 620
//

Text Mined References (51)

PMID Year Title