Property Summary

NCBI Gene PubMed Count 40
PubMed Score 48.68
PubTator Score 26.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.014 2.0e-03
osteosarcoma -1.278 1.8e-05
primary pancreatic ductal adenocarcinoma -1.088 3.8e-03
colon cancer 2.800 3.3e-02
sonic hedgehog group medulloblastoma 1.200 6.2e-06
Pick disease -1.200 2.3e-04
ovarian cancer -1.900 7.1e-07

Gene RIF (5)

PMID Text
20508983 Observational study of gene-disease association. (HuGE Navigator)
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19460752 Knockdown of cell division cycle 16 homolog (S. cerevisiae) (CDC16) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
12629511 We report gene alterations in several components of this complex in human colon cancer cells, including APC6/CDC16 and APC8/CDC23 which are known to be key function elements.
12029633 TFDP1, CUL4A, and CDC16 are probable targets of an amplification mechanism and therefore may be involved, together or separately, in development and/or progression of some hepatocellular carcinomas

AA Sequence

MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYE      1 - 70
ACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIY     71 - 140
DALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLK    141 - 210
KYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNK    211 - 280
ANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEH    281 - 350
DQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKT    351 - 420
AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHS    421 - 490
LMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIIS    491 - 560
PPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST              561 - 620
//

Text Mined References (49)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21926987 2011 APC15 drives the turnover of MCC-CDC20 to make the spindle assembly checkpoint responsive to kinetochore attachment.
21269460 2011 Initial characterization of the human central proteome.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20056645 2010 Association of mitotic regulation pathway polymorphisms with pancreatic cancer risk and outcome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19668213 2009 Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18485873 2008 Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16364912 2005 Localization of the coactivator Cdh1 and the cullin subunit Apc2 in a cryo-electron microscopy model of vertebrate APC/C.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657031 2003 Mitotic regulation of the human anaphase-promoting complex by phosphorylation.
14593737 2003 The mitotic checkpoint: a signaling pathway that allows a single unattached kinetochore to inhibit mitotic exit.
12629511 2003 Alterations of anaphase-promoting complex genes in human colon cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12196507 2002 Rapid microtubule-independent dynamics of Cdc20 at kinetochores and centrosomes in mammalian cells.
12070128 2002 Human securin proteolysis is controlled by the spindle checkpoint and reveals when the APC/C switches from activation by Cdc20 to Cdh1.
12029633 2002 TFDP1, CUL4A, and CDC16 identified as targets for amplification at 13q34 in hepatocellular carcinomas.
11742988 2001 APC/C-mediated destruction of the centrosomal kinase Nek2A occurs in early mitosis and depends upon a cyclin A-type D-box.
11691834 2001 Smad3 recruits the anaphase-promoting complex for ubiquitination and degradation of SnoN.
11535616 2001 Checkpoint inhibition of the APC/C in HeLa cells is mediated by a complex of BUBR1, BUB3, CDC20, and MAD2.
11340163 2001 A conserved cyclin-binding domain determines functional interplay between anaphase-promoting complex-Cdh1 and cyclin A-Cdk2 during cell cycle progression.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11179667 2001 Characterisation of the human APC1, the largest subunit of the anaphase-promoting complex.
10922056 2000 The RING-H2 finger protein APC11 and the E2 enzyme UBC4 are sufficient to ubiquitinate substrates of the anaphase-promoting complex.
10793135 2000 Mitotic regulation of the APC activator proteins CDC20 and CDH1.
10548110 1999 Accumulation of cyclin B1 requires E2F and cyclin-A-dependent rearrangement of the anaphase-promoting complex.
10500174 1999 Expression of the CDH1-associated form of the anaphase-promoting complex in postmitotic neurons.
10477750 1999 Human BUBR1 is a mitotic checkpoint kinase that monitors CENP-E functions at kinetochores and binds the cyclosome/APC.
10318877 1999 Characterization of the DOC1/APC10 subunit of the yeast and the human anaphase-promoting complex.
9628895 1998 Mammalian p55CDC mediates association of the spindle checkpoint protein Mad2 with the cyclosome/anaphase-promoting complex, and is involved in regulating anaphase onset and late mitotic events.
9469815 1998 Identification of a cullin homology region in a subunit of the anaphase-promoting complex.
9405394 1997 The serine/threonine phosphatase PP5 interacts with CDC16 and CDC27, two tetratricopeptide repeat-containing subunits of the anaphase-promoting complex.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7736578 1995 CDC27Hs colocalizes with CDC16Hs to the centrosome and mitotic spindle and is essential for the metaphase to anaphase transition.