Property Summary

NCBI Gene PubMed Count 45
PubMed Score 14.20
PubTator Score 44.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Pulmonary function (finding) 33
Disease Target Count P-value
ovarian cancer 8491 8.9e-04
Multiple myeloma 1327 2.2e-03
lung cancer 4473 2.1e-02
Breast cancer 3098 2.8e-02
Disease Target Count Z-score Confidence
diabetes mellitus 1663 3.322 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.150 2.2e-03
lung cancer 1.500 2.1e-02
Breast cancer 2.500 2.8e-02
ovarian cancer 1.700 8.9e-04

Synonym

Accession O75794 A8JZZ7 Q14107 Q5T0L4 Q5T0L5 Q5T0L7 Q5T0L8 Q5T0L9 Protein D123
Symbols D123
C10orf7

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Pathway (1)

Protein-protein Interaction (5)

Gene RIF (30)

PMID Text
25976611 CDC123 may have a role in novel protein modifications
22923468 Association to type 2 diabetes was found for rs13266634 (SLC30A8), rs7923837 (HHEX), rs10811661 (CDKN2A/2B), rs4402960 (IGF2BP2), rs12779790 (CDC123/CAMK1D), and rs2237892 (KCNQ1).
21909839 A significant association of rs10906115 in CDC123/CAMK1D and rs1359790 near SPRY2 was identified with type 2 diabetes in a Japanese population.
20927120 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20879858 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20816152 Observational study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20490451 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20161779 Observational study of gene-disease association. (HuGE Navigator)
20075150 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19933996 Observational study of gene-disease association. (HuGE Navigator)
19833888 Observational study of gene-disease association. (HuGE Navigator)
19794065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19741467 Observational study of gene-disease association. (HuGE Navigator)
19720844 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19670153 Observational study of gene-disease association. (HuGE Navigator)
19602701 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
19502414 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19247373 Observational study of gene-disease association. (HuGE Navigator)
19139842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19020324 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19020323 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18714373 Observational study of gene-disease association. (HuGE Navigator)
18591388 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18567820 Observational study of gene-disease association. (HuGE Navigator)
18372903 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKKEHVLHCQFSAWYPFFRGVTIKSVILPLPQNVKDYLLDDGTLVVSGRDDPPTHSQPDSDDEAEEIQWS      1 - 70
DDENTATLTAPEFPEFATKVQEAINSLGGSVFPKLNWSAPRDAYWIAMNSSLKCKTLSDIFLLFKSSDFI     71 - 140
TRDFTQPFIHCTDDSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEIR    141 - 210
RCIQDFFKKHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFGEVTDSLLFTWEELISENNLNGDFSEVDAQ    211 - 280
EQDSPAFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD                  281 - 336
//

Text Mined References (47)

PMID Year Title
25976611 2015 The eukaryotic translation initiation regulator CDC123 defines a divergent clade of ATP-grasp enzymes with a predicted role in novel protein modifications.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
22961080 2013 A genome-wide association study identifies GRK5 and RASGRP1 as type 2 diabetes loci in Chinese Hans.
22923468 2012 Contribution of common genetic variation to the risk of type 2 diabetes in the Mexican Mestizo population.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21909839 2011 Genetic variants at CDC123/CAMK1D and SPRY2 are associated with susceptibility to type 2 diabetes in the Japanese population.
21269460 2011 Initial characterization of the human central proteome.
20927120 2010 Variations in/nearby genes coding for JAZF1, TSPAN8/LGR5 and HHEX-IDE and risk of type 2 diabetes in Han Chinese.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20879858 2010 Impact of single nucleotide polymorphisms and of clinical risk factors on new?onset diabetes mellitus in HIV?infected individuals.
20862305 2010 Identification of new genetic risk variants for type 2 diabetes.
20816152 2010 Obesity and diabetes genetic variants associated with gestational weight gain.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20490451 2010 Type 2 diabetes risk alleles near ADCY5, CDKAL1 and HHEX-IDE are associated with reduced birthweight.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20161779 2010 Investigation of type 2 diabetes risk alleles support CDKN2A/B, CDKAL1, and TCF7L2 as susceptibility genes in a Han Chinese cohort.
20075150 2010 Utility of genetic and non-genetic risk factors in prediction of type 2 diabetes: Whitehall II prospective cohort study.
19933996 2010 Examination of all type 2 diabetes GWAS loci reveals HHEX-IDE as a locus influencing pediatric BMI.
19833888 2010 Gene variants in the novel type 2 diabetes loci CDC123/CAMK1D, THADA, ADAMTS9, BCL11A, and MTNR1B affect different aspects of pancreatic beta-cell function.
19794065 2010 Polygenic risk variants for type 2 diabetes susceptibility modify age at diagnosis in monogenic HNF1A diabetes.
19741467 2009 Association of common type 2 diabetes risk gene variants and posttransplantation diabetes mellitus in renal allograft recipients in Korea.
19720844 2009 Use of multiple metabolic and genetic markers to improve the prediction of type 2 diabetes: the EPIC-Potsdam Study.
19670153 2010 Lack of significant effects of the type 2 diabetes susceptibility loci JAZF1, CDC123/CAMK1D, NOTCH2, ADAMTS9, THADA, and TSPAN8/LGR5 on diabetes and quantitative metabolic traits.
19602701 2009 Underlying genetic models of inheritance in established type 2 diabetes associations.
19502414 2009 Association of 18 confirmed susceptibility loci for type 2 diabetes with indices of insulin release, proinsulin conversion, and insulin sensitivity in 5,327 nondiabetic Finnish men.
19247373 2009 Testing the association of novel meta-analysis-derived diabetes risk genes with type II diabetes and related metabolic traits in Asian Indian Sikhs.
19139842 2009 Risk prediction of prevalent diabetes in a Swiss population using a weighted genetic score--the CoLaus Study.
19020324 2008 Clinical risk factors, DNA variants, and the development of type 2 diabetes.
19020323 2008 Genotype score in addition to common risk factors for prediction of type 2 diabetes.
18714373 2008 Novel meta-analysis-derived type 2 diabetes risk loci do not determine prediabetic phenotypes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18591388 2008 Assessing the combined impact of 18 common genetic variants of modest effect sizes on type 2 diabetes risk.
18567820 2008 Association testing of novel type 2 diabetes risk alleles in the JAZF1, CDC123/CAMK1D, TSPAN8, THADA, ADAMTS9, and NOTCH2 loci with insulin release, insulin sensitivity, and obesity in a population-based sample of 4,516 glucose-tolerant middle-aged Danes.
18372903 2008 Meta-analysis of genome-wide association data and large-scale replication identifies additional susceptibility loci for type 2 diabetes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15319434 2004 Cdc123 and checkpoint forkhead associated with RING proteins control the cell cycle by controlling eIF2gamma abundance.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10942595 2000 A visual intracellular classification strategy for uncharacterized human proteins.
9683532 1998 Expression study on D123 gene product: evidence for high positivity in testis.
8601400 1996 An amino acid change in novel protein D123 is responsible for temperature-sensitive G1-phase arrest in a mutant of rat fibroblast line 3Y1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.