Property Summary

NCBI Gene PubMed Count 83
PubMed Score 503.13
PubTator Score 968.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Mammary Neoplasms 410
Disease Target Count Z-score Confidence
Cancer 2346 4.26 2.1

Expression

  Differential Expression (8)

Disease log2 FC p
gastric cancer -1.400 4.4e-03
esophageal adenocarcinoma -2.500 1.9e-02
psoriasis -1.600 1.9e-03
osteosarcoma -3.691 1.2e-04
tuberculosis 1.300 2.7e-04
pancreatic cancer 1.100 1.4e-04
interstitial cystitis 1.100 5.1e-05
mucosa-associated lymphoid tissue lympho... 2.183 2.5e-02

Synonym

Accession P32320
Symbols CDD

Gene

CDA

PANTHER Protein Class (2)

PDB

1MQ0  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (12)

Gene RIF (71)

PMID Text
26418006 Single nucleotide polymorphisms in cytidine deaminase gene were associated with the efficacy of gemcitabine in Biliary Tract Cancer.
26354033 results indicate that rs2072671 in CDA may be an important prognostic marker in NK-AML patients.
26200337 tumor cell lines that are susceptible to epigenetic nucleosides overexpress cytidine deaminase (CDA); CDA converts 5hmdC and 5fdC into variants of uridine that are incorporated into DNA, resulting in accumulation of DNA damage, and ultimately, cell death
26181065 stimulation of PARP-1 activity in CDA-deficient cells restores replication and, thus, chromosome segregation. Moreover, increasing intracellular dCTP levels generates under-replication-induced sister-chromatid bridges as efficiently as PARP-1 knockdown
26090398 n the multivariate Cox regression analysis, we found that age at diagnosis, wild-type genotype of the CDA A79C polymorphism, and wild-type genotype of the dCK C360G polymorphism were the most significant prognostic factors for predicting the risk of death
26083014 RNA expression of deoxycytidine kinase (DCK), human equilibrative nucleoside transporter-1 (ENT1) and ribonucleotide reductase M1 (RRM1) were significantly higher and cytidine deaminase (CDA) was significantly lower in ex vivo Ara-C sensitive samples.
25850965 This case report calls for further prospective studies investigating the exact role that CDA status plays in the clinical outcome of patients treated with azacytidine.
25691056 Polymorphisms in ABCB1, CDA, ENOSF1,and TYMS could help to predict specific and overall severe adverse reactions to capecitabine.
25643696 miR-484-modulated cytidine deaminase has a dual impact in promoting chemoresistance and suppressing cell proliferation in breast cancer
25582275 These results suggest that CDA 79A>C polymorphisms is a potential biomarker for toxicity of gemcitabine-based chemotherapy and a CDA testing before gemcitabine administration is preferred.
24841663 These results provide suggestive evidence of a favorable effect for the XPD 312Asp/Asp and XPD 751Lys/Lys genotypes with respect to overall survival rates in platinum-treated NSCLC patients
24557790 The A79C CDA polymorphism did not show a significant impact on the response rate to gemcitabine in NSCLC patients, while the wild type CDA genotype was indeed correlated to a lower rate of incidence of severe anemia in patients taking gemcitabine.
24183806 The T70 variant has a lower catalytic efficiency toward the analyzed substrates when compared to the A70 variant, suggesting that patients carrying the 208G>A SNP may have a greater exposure to cytosine based pro drugs
23995783 Macrophages mediate gemcitabine resistance of pancreatic adenocarcinoma by upregulating cytidine deaminase.
23837479 ultrarapid metabolizer patients are nearly five-times more likely to have progressive disease than patients with normal or low CDA activities.
23736036 Variation in the DPYD, TYMS, CDA and MTHFR genes are clinically significant predictors of fluoropyrimidine toxicity.
23651026 Carriers of the CDA*2B haplotype displayed higher CDA activity.
23033855 Studied human CDA using site-directed mutagenesis: through these studies it was possible to understand the role exerted by specific amino acid residues in CDA active site and in the contacts between subunits.
22884143 It is evident that the DCK and CDA polymorphisms might be the important markers for the AML patients' therapy outcomes in a Chinese population.
22592598 Data indicate cytidine deaminase rapid expression upon doxycycline application in mouse haematopoietic system.
22546611 Chinese patients carrying A79C variant C allele of CDA were found to be at higher risk of developing severe neutropenia after gemcitabine-based chemotherapy.
22304580 CDA RNA expression as well as Ara-C IC showed wide variation in AML samples and normal controls.
22052224 Cytidine deaminase (CDA) 435 T/T genotype was significantly associated with better response to treatment and the CDA 435 C/T genotype was associated with a significantly increased risk of nonhematological toxicity.
21858090 Data show that the CDA/DCK ratio was 3 fold higher in non-responders than responders (P<.05), suggesting that this could be a mechanism of primary resistance.
21652582 cytidine deaminase enzymatic activity appears to be the strongest candidate biomarker of activity and efficacy of platinum-gemcitabine-based chemotherapy in advanced non-small-cell lung cancer patients
21625252 In conclusion, in this prospective randomized adjuvant study of patients with pancreatic cancer, the cytidine deaminase polymorphism is validated as a predictive marker of gemcitabine hematological toxicity, but not with treatment response or survival
21538122 Aberrant activation-induced cytidine deaminase expression is correlated with persistent inflammatory condition induced by H. pylori infection and may contribute to the development of gastric cancer through an inflammatory condition and intestinalization.
21332653 Single nucleotide polymorphisms in cytidine deaminase is associated with the pharmacological advantage of prolonged dose rate gemcitabine.
21325291 the deleted allele of rs3215400 in the promoter of cytidine deaminase shows an increased allele-specific expression and is significantly associated with an increased risk of capecitabine-induced hand-foot syndrome
20890066 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20665488 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20637228 These investigations reinforced the hypothesis that in human CDA the side chain of Y33 is involved in intersubunit interactions with four glutamate residues forming a double latch that connects each of the two pairs of monomers of the tetrameric CDA.
20608756 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20563566 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20213492 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20211060 Compared with their parental cells, the expressions of CDA, RRM1, PTEN and ERCC1 increase in human gemcitabine-resistant non-small cell lung cancer cell lines.
20196672 Activation-induced cytidine deaminase expression suggests diffuse large B-cell lymphoma may arise from a putative interfollicular large B cell.
20173083 Observational study of genotype prevalence. (HuGE Navigator)
20045991 Observational study of genotype prevalence. (HuGE Navigator)
20028759 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19941076 The aim of this study was also to assess the distribution of genotypic variants of CDA in a central Italy population.
19941076 Observational study of genotype prevalence. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19889077 Curcumin downregulated Helicobacter pylori induced cytidine deaminase expression in gastric epithelial cells.
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19458626 Single Nucleotide Polymorphism in cytidine deaminase is associated with Acute Myeloid Leukemia.
19293806 Homozygous cytidine deaminase, CDA*3, is a major cause of life-threatening toxicities in gemcitabine-treated Japanese cancer patients.
19035178 The cytidine deaminase 208A genotype is shown to be more sensitive to cytosine arabinoside than the 208G genotype in childhood acute leukemia.
18775979 In leukoblasts from 82 patients with acute myeloid leukemia, various extent and frequency of differential allelic expression in the CDA, DCK, NT5C2, NT5C3, and TP53 genes was observed.
18762567 Results provide evidence for a new regulatory mechanism that restricts activation-induced cytidine deaminase activity and can therefore be relevant to prevent B cell malignant transformation.
18600531 Observational study of gene-disease association. (HuGE Navigator)
18538445 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18537153 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18347182 The role of CDA Lys(27)Lys polymorphism as a possible predictive marker of activity, toxicity, time to progression, and overall survival in advanced NSCLC patients treated with cisplatin and gemcitabine.
18347182 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17640070 in the human cytidine deaminase, the side chain of arginine 68 involved in the catalytic process in one subunit active site might come from another subunit
17479107 After gene trasfer of CDA, this enzyme plus 5-fluorocytosine with TRAIL may be useful for the therapy of tumors resistant to TRAIL.
17464349 Described the identification and characterization of HSCD, which is the product of alternative splicing of the HCD gene
17194903 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16507781 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16446974 6 SNPs ( -92A>G, -205C>G, -451C>T, -897C>A, -1075A>G and -1181G>A) in promoter of CDA may influence Ara-C chemosensitivity.
16304576 Gene transfer increased the resistance of CDD-transduced cord blood and peripheral blood-derived progenitor cells for 20-100 nM cytarabine and 8-10 nM gemcitabine. Protection was observed for progenitors of erythroid as well as myeloid differentiation.
16303324 Molecular model of cytidine deaminase.
15713780 analysis of isoenzymatic forms of human cytidine deaminase
14744791 Presence of several GATA1 binding sites in the CDAsf promoter and the uniform detection of GATA1 mutations in DS megakaryocytic leukemia suggested the potential role of GATA1 in regulating CDA transcription.
14565461 Understanding the catalytic mechanism by crystallization of the E. coli homolog
14565460 Intersubunit interactions in human cytidine deaminase using wild and recombinant, amino acid-substituted enzymes
12844405 The level of CDD mRNA expression varies at the different stage of acute leukemia. The expression level of CDD seems not to be a prognostic factor.
12651944 This enzyme can act on deoxycytidine in single-stranded DNA, but requires the action of RNase A.
12113294 serum adenosine deaminase and cytidine deaminase levels were significantly higher in systemic lupus erythematosus patients

AA Sequence

MAQKRPACTLKPECVQQLLVCSQEAKKSAYCPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTA      1 - 70
IQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPE     71 - 140
DLQKTQ                                                                    141 - 146
//

Text Mined References (83)

PMID Year Title
26418006 2015 Cytidine Deaminase as a Molecular Predictor of Gemcitabine Response in Patients with Biliary Tract Cancer.
26354033 2015 Cytidine deaminase polymorphisms and worse treatment response in normal karyotype AML.
26200337 2015 CDA directs metabolism of epigenetic nucleosides revealing a therapeutic window in cancer.
26181065 2015 Pyrimidine Pool Disequilibrium Induced by a Cytidine Deaminase Deficiency Inhibits PARP-1 Activity, Leading to the Under Replication of DNA.
26090398 2015 Role of Genetic Polymorphisms of Deoxycytidine Kinase and Cytidine Deaminase to Predict Risk of Death in Children with Acute Myeloid Leukemia.
26083014 2015 RNA expression of genes involved in cytarabine metabolism and transport predicts cytarabine response in acute myeloid leukemia.
25850965 2015 Lethal toxicity after administration of azacytidine: implication of the cytidine deaminase-deficiency syndrome.
25691056 2015 Variants in CDA and ABCB1 are predictors of capecitabine-related adverse reactions in colorectal cancer.
25643696 2015 Cytidine Deaminase Axis Modulated by miR-484 Differentially Regulates Cell Proliferation and Chemoresistance in Breast Cancer.
25582275 2015 Cytidine deaminase polymorphism predicts toxicity of gemcitabine-based chemotherapy.
25416956 2014 A proteome-scale map of the human interactome network.
24841663 2014 Association of xeroderma pigmentosum group D (Asp312Asn, Lys751Gln) and cytidine deaminase (Lys27Gln, Ala70Thr) polymorphisms with outcome in Chinese non-small cell lung cancer patients treated with cisplatin-gemcitabine.
24557790 The impact of CDA A79C gene polymorphisms on the response and hematologic toxicity in gemcitabine-treated patients: a meta-analysis.
24183806 2014 Human cytidine deaminase: a biochemical characterization of its naturally occurring variants.
23995783 2014 Macrophages mediate gemcitabine resistance of pancreatic adenocarcinoma by upregulating cytidine deaminase.
23837479 2013 Rapid deaminator status is associated with poor clinical outcome in pancreatic cancer patients treated with a gemcitabine-based regimen.
23736036 2013 Pharmacogenetic variants in the DPYD, TYMS, CDA and MTHFR genes are clinically significant predictors of fluoropyrimidine toxicity.
23651026 2013 CDA gene polymorphisms and enzyme activity: genotype-phenotype relationship in an Italian-Caucasian population.
23033855 2013 Site directed mutagenesis as a tool to understand the catalytic mechanism of human cytidine deaminase.
22884143 2012 Association of polymorphisms of cytosine arabinoside-metabolizing enzyme gene with therapeutic efficacy for acute myeloid leukemia.
22592598 2013 Efficient in vivo regulation of cytidine deaminase expression in the haematopoietic system using a doxycycline-inducible lentiviral vector system.
22546611 2012 High incidence of severe neutropenia after gemcitabine-based chemotherapy in Chinese cancer patients with CDA 79A>C mutation.
22304580 2012 Cytidine deaminase genetic variants influence RNA expression and cytarabine cytotoxicity in acute myeloid leukemia.
22052224 2011 Association of cytidine deaminase and xeroderma pigmentosum group D polymorphisms with response, toxicity, and survival in cisplatin/gemcitabine-treated advanced non-small cell lung cancer patients.
21858090 2011 Mechanisms of resistance to decitabine in the myelodysplastic syndrome.
21652582 2012 Correlation of cytidine deaminase polymorphisms and activity with clinical outcome in gemcitabine-/platinum-treated advanced non-small-cell lung cancer patients.
21625252 2012 Cytidine deaminase single-nucleotide polymorphism is predictive of toxicity from gemcitabine in patients with pancreatic cancer: RTOG 9704.
21538122 2011 Aberrant activation-induced cytidine deaminase expression is associated with mucosal intestinalization in the early stage of gastric cancer.
21332653 2011 The pharmacological advantage of prolonged dose rate gemcitabine is restricted to patients with variant alleles of cytidine deaminase c.79A>C.
21325291 2011 A polymorphism in the cytidine deaminase promoter predicts severe capecitabine-induced hand-foot syndrome.
20890066 2010 Effect of genetic alterations of cytarabine- metabolizing enzymes in childhood acute lymphoblastic leukemia.
20665488 2010 Gemcitabine metabolic and transporter gene polymorphisms are associated with drug toxicity and efficacy in patients with locally advanced pancreatic cancer.
20637228 2010 Role of tyrosine 33 residue for the stabilization of the tetrameric structure of human cytidine deaminase.
20608756 2010 Population pharmacokinetics of gemcitabine and its metabolite in Japanese cancer patients: impact of genetic polymorphisms.
20563566 2010 Letter to the editor: pharmacokinetics of gemcitabine in non-small-cell lung cancer patients: impact of the 79A>C cytidine deaminase polymorphism.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20213492 2010 Pharmacokinetics of gemcitabine in non-small-cell lung cancer patients: impact of the 79A>C cytidine deaminase polymorphism.
20211060 2010 [Expression of Gemcitabine-resistance-related gene and polymorphism of ribonucleotide reductase M1 gene promoter in Gemcitabine-resistant A549/Gem and NCI-H460/Gem cell lines].
20196672 2010 Activation-induced cytidine deaminase expression in diffuse large B-cell lymphoma with a paracortical growth pattern: a lymphoma of possible interfollicular large B-cell origin.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
20045991 2009 Ethnic differences of two non-synonymous single nucleotide polymorphisms in CDA gene.
20028759 2010 Single nucleotide polymorphisms of gemcitabine metabolic genes and pancreatic cancer survival and drug toxicity.
19941076 2010 PCR-based methods for CDA K27Q and A70T genotyping: genotypes and alleles distribution in a central Italy population.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19889077 2009 Modulation of activation-induced cytidine deaminase by curcumin in Helicobacter pylori-infected gastric epithelial cells.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19458626 2009 SNP analyses in cytarabine metabolizing enzymes in AML patients and their impact on treatment response and patient survival: identification of CDA SNP C-451T as an independent prognostic parameter for survival.
19293806 2009 Homozygous CDA*3 is a major cause of life-threatening toxicities in gemcitabine-treated Japanese cancer patients.
19035178 2008 [Study on the relationship between human cytidine deaminase gene polymorphisms and Ara-C sensitivity].
18775979 2008 Differential allelic expression in leukoblast from patients with acute myeloid leukemia suggests genetic regulation of CDA, DCK, NT5C2, NT5C3, and TP53.
18762567 2008 miR-181b negatively regulates activation-induced cytidine deaminase in B cells.
18600531 2008 Correlation between cytidine deaminase genotype and gemcitabine deamination in blood samples.
18538445 2009 Distribution of gemcitabine pathway genotypes in ethnic Asians and their association with outcome in non-small cell lung cancer patients.
18537153 2008 Dihydropyrimidine dehydrogenases and cytidine-deaminase gene polymorphisms as outcome predictors in resected gastric cancer patients treated with fluoropyrimidine adjuvant chemotherapy.
18347182 2008 Correlation of CDA, ERCC1, and XPD polymorphisms with response and survival in gemcitabine/cisplatin-treated advanced non-small cell lung cancer patients.
17640070 2008 Modulation of human cytidine deaminase by specific aminoacids involved in the intersubunit interactions.
17479107 2007 Cytosine deaminase/5-fluorocytosine gene therapy and Apo2L/TRAIL cooperate to kill TRAIL-resistant tumor cells.
17464349 2007 Cloning and characterization of an alternative splicing transcript of the gene coding for human cytidine deaminase.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17194903 2007 Pharmacokinetics of gemcitabine in Japanese cancer patients: the impact of a cytidine deaminase polymorphism.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16507781 2006 Genomic polymorphisms provide prognostic information in intermediate-risk acute myeloblastic leukemia.
16446974 2006 Identification of functional single nucleotide polymorphism haplotypes in the cytidine deaminase promoter.
16304576 2005 Resistance to cytarabine and gemcitabine and in vitro selection of transduced cells after retroviral expression of cytidine deaminase in human hematopoietic progenitor cells.
16303324 2006 Human cytidine deaminase: a three-dimensional homology model of a tetrameric metallo-enzyme inferred from the crystal structure of a distantly related dimeric homologue.
15713780 2004 Isoenzymatic forms of human cytidine deaminase.
15689149 2005 Structure of human cytidine deaminase bound to a potent inhibitor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983087 2003 Functional properties of subunit interactions in human cytidine deaminase.
14744791 2004 The role of cytidine deaminase and GATA1 mutations in the increased cytosine arabinoside sensitivity of Down syndrome myeloblasts and leukemia cell lines.
14565461 Human cytidine deaminase: understanding the catalytic mechanism.
14565460 Intersubunit interactions in human cytidine deaminase.
12844405 2003 [Expression of cytidine deaminase mRNA in bone marrow cells from patients with acute leukemia].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12113294 2002 Serum adenosine deaminase and cytidine deaminase activities in patients with systemic lupus erythematosus.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
10497201 1999 Intracellular localization of human cytidine deaminase. Identification of a functional nuclear localization signal.
9878810 1998 Isolation and characterization of the gene coding for human cytidine deaminase.
9596658 1998 Growth inhibition of granulocyte-macrophage colony-forming cells by human cytidine deaminase requires the catalytic function of the protein.
8422236 1993 Cloning of a functional cDNA for human cytidine deaminase (CDD) and its use as a marker of monocyte/macrophage differentiation.
8001985 1994 Assignment of the human cytidine deaminase (CDA) gene to chromosome 1 band p35-p36.2.
7923172 1994 Human cytidine deaminase: purification of enzyme, cloning, and expression of its complementary DNA.
53069 1975 On the interaction of 3,4,5,6-tetrahydrouridine with human liver cytidine deaminase.