Property Summary

Ligand Count 1
NCBI Gene PubMed Count 34
PubMed Score 551.06
PubTator Score 487.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma 1.300 1.9e-02
atypical teratoid / rhabdoid tumor 1.400 3.6e-02
breast carcinoma 1.100 4.5e-02
chronic kidney disease 1.200 2.6e-02
colon cancer -1.500 2.2e-02
cutaneous lupus erythematosus 1.700 1.8e-02
ductal carcinoma in situ 2.000 2.3e-02
head and neck cancer -1.200 4.7e-02
head and neck cancer and chronic obstruc... 1.100 1.8e-02
interstitial cystitis 2.500 2.1e-03
invasive ductal carcinoma 1.353 1.2e-02
lung adenocarcinoma -1.500 4.3e-06
lung cancer -4.100 1.4e-07
lung carcinoma -3.800 2.0e-38
nasopharyngeal carcinoma -1.200 1.2e-02
nephrosclerosis 1.511 1.3e-02
non-small cell lung cancer -2.984 1.4e-23
osteosarcoma -2.644 1.7e-03
ovarian cancer -1.900 1.6e-04
pancreatic cancer 1.100 4.4e-02
pituitary cancer 1.500 2.0e-02
primary Sjogren syndrome 1.300 1.0e-03
psoriasis -1.700 3.5e-03
tuberculosis 1.300 8.9e-07
ulcerative colitis 1.700 9.3e-03
Waldenstrons macroglobulinemia 1.290 1.2e-02

Gene RIF (17)

AA Sequence

MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS               1 - 61
//

Text Mined References (35)

PMID Year Title