Property Summary

NCBI Gene PubMed Count 33
PubMed Score 526.03
PubTator Score 487.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
nephrosclerosis 1.511 1.3e-02
Waldenstrons macroglobulinemia 1.838 3.8e-02
cutaneous lupus erythematosus 1.700 1.8e-02
psoriasis -1.700 3.5e-03
osteosarcoma -4.231 1.1e-04
atypical teratoid / rhabdoid tumor 1.400 3.6e-02
chronic kidney disease 1.200 2.6e-02
tuberculosis 1.400 1.0e-06
non-small cell lung cancer -3.127 7.2e-24
colon cancer -1.500 2.2e-02
lung cancer -5.800 8.1e-08
pancreatic cancer 1.100 4.4e-02
breast carcinoma 1.100 4.5e-02
interstitial cystitis 2.700 1.8e-03
adult high grade glioma 1.300 1.9e-02
primary Sjogren syndrome 1.300 1.0e-03
lung adenocarcinoma -2.533 4.6e-06
invasive ductal carcinoma 1.970 3.8e-03
nasopharyngeal carcinoma -1.400 2.4e-02
lung carcinoma -3.800 2.0e-38
ductal carcinoma in situ 2.100 1.9e-02
ulcerative colitis 2.500 4.2e-04
ovarian cancer -1.900 1.6e-04
pituitary cancer 2.000 3.6e-03
head and neck cancer -1.500 2.1e-02
head and neck cancer and chronic obstruc... 1.100 1.8e-02

Gene RIF (17)

PMID Text
24799522 CD52 is a novel prognostic NSC marker and a potential NSC target in a subset of patients with MDS and AML, which may have clinical implications and may explain clinical effects produced by alemtuzumab in these patients.
22491736 A molecular and computational diagnostic approach identifies FOXP3, ICOS, CD52 and CASP1 as the most informative biomarkers in acute graft-versus-host disease.
22386526 carbohydrate moiety of sperm protein interferes with the complement system via binding to C1q
21552305 CT60 single-nucleotide polymorphism of CTLA4 is a surrogate marker for donor lymphocyte infusion outcome after allogeneic cell transplantation for acute leukemia
20349607 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20349607 Our bioinformatics findings suggest that CD52 polymorphism may affect the efficiency of GPI anchor formation and thus may indirectly alter the response to anti-CD52 agents like alemtuzumabin renal transplantation.
19794084 Clonal large granular lymphocytes exhibited decreased CD52 expression post-therapy in patients refractory to treatment.
18647288 We first showed the expression of CD52 in human cumulus cells. CD52 has some functional roles around fertilization in females as well as in males.
17624925 The semenogelin-CD52 soluble form is a direct consequence of the liquefaction process in human semen.
17428002 Our data demonstrate differences in the intensity of the CD52 antigen expression between B-lymphocytes and tumor lymphocytes of B-CLL patients, and between B-CLL and SLL tumor cells. CD52 antigen is expressed at low level on CD34(+) cells.
17145843 In contrast with CLL, the variable expression of CD52 among other hematologic malignancies suggests that target validation on a case-by-case basis will likely be necessary to guide the rational analysis of CAMPATH therapy.
16797237 In this study, we identified the antigen of 4C8 mAb as CD52. CD52 is a costimulatory molecule for induction of CD4-positive T cells.
16796779 CD52 is widely expressed on human mast cells (MCs) and Waldenstrom's Macroglobulinemia bone marrow lymphoplasmacytic cells and provide the preclinical rationale for the use of alemtuzumab in the treatment of WM and possibly other MC-related disorders.
16266689 The relationship between this differential insertion and differences in glycosylation of rat and human CD52 is discussed.
14662784 HE5(CD52) mRNA and protein, expressed in epithelial cells of the distal epididymis, were not affected by the obstruction of the vas deferens.
11860230 Review article on CD52 structure and function.
11257744 A review on CD52 expression and function

AA Sequence

MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS               1 - 61
//

Text Mined References (34)

PMID Year Title
24799522 2014 Identification of campath-1 (CD52) as novel drug target in neoplastic stem cells in 5q-patients with MDS and AML.
22491736 2012 A molecular and computational diagnostic approach identifies FOXP3, ICOS, CD52 and CASP1 as the most informative biomarkers in acute graft-versus-host disease.
22386526 2012 The N-linked carbohydrate moiety of male reproductive tract CD52 (mrt-CD52) interferes with the complement system via binding to C1q.
21552305 2012 CT60 single-nucleotide polymorphism as a surrogate marker for donor lymphocyte infusion outcome after allogeneic cell transplantation for acute leukemia.
20349607 2009 CD52 gene polymorphism and its potential effect on the response to alemtuzumab in renal transplant recipients.
19794084 2009 Therapeutic implications of variable expression of CD52 on clonal cytotoxic T cells in CD8+ large granular lymphocyte leukemia.
18647288 2008 CD52 is synthesized in cumulus cells and secreted into the cumulus matrix during ovulation.
17624925 2008 The GPI-anchored CD52 antigen of the sperm surface interacts with semenogelin and participates in clot formation and liquefaction of human semen.
17428002 2007 Different levels of CD52 antigen expression evaluated by quantitative fluorescence cytometry are detected on B-lymphocytes, CD 34+ cells and tumor cells of patients with chronic B-cell lymphoproliferative diseases.
17145843 2006 Heterogeneous CD52 expression among hematologic neoplasms: implications for the use of alemtuzumab (CAMPATH-1H).
16797237 2006 CD52 is a novel costimulatory molecule for induction of CD4+ regulatory T cells.
16796779 2006 CD52 is expressed on human mast cells and is a potential therapeutic target in Waldenstrom's Macroglobulinemia and mast cell disorders.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16266689 2005 Different glycoforms of the human GPI-anchored antigen CD52 associate differently with lipid microdomains in leukocytes and sperm membranes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14662784 Vasectomy influences expression of HE1 but not HE2 and HE5 genes in human epididymis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12113063 2002 CAMPATH (alemtuzumab) for the treatment of chronic lymphocytic leukemia and beyond.
11860230 CD52 (CAMPATH1).
11257744 CD52 antigen--a review.
10561018 1999 The role of CAMPATH-1 antibodies in the treatment of lymphoid malignancies.
10524207 1999 Structure and chromosomal location of mouse and human CD52 genes.
9361796 1997 The molecular biology of the sperm surface. Post-testicular membrane remodelling.
8977262 1996 Surface and mRNA expression of the CD52 antigen by human eosinophils but not by neutrophils.
8418821 1993 A major mRNA of the human epididymal principal cells, HE5, encodes the leucocyte differentiation CDw52 antigen peptide backbone.
8418812 1993 Region-specific variation of gene expression in the human epididymis as revealed by in situ hybridization with tissue-specific cDNAs.
8366859 1993 Efficient complement-mediated lysis of cells containing the CAMPATH-1 (CDw52) antigen.
8223854 1993 Activation of human monocytes and granulocytes by monoclonal antibodies to glycosylphosphatidylinositol-anchored antigens.
7890742 1995 Primary structure of CD52.
7718516 1995 Cross-linking of the CAMPATH-1 antigen (CD52) triggers activation of normal human T lymphocytes.
7688956 1993 Structure of the CAMPATH-1 antigen, a glycosylphosphatidylinositol-anchored glycoprotein which is an exceptionally good target for complement lysis.
7685389 1993 The glycosylphosphatidylinositol-anchored lymphocyte antigen CDw52 is associated with the epididymal maturation of human spermatozoa.
1711975 1991 Characterization of the CAMPATH-1 (CDw52) antigen: biochemical analysis and cDNA cloning reveal an unusually small peptide backbone.
1352921 1992 The distribution of the CDW52 molecule on blood cells and characterization of its involvement in T cell activation.