Property Summary

NCBI Gene PubMed Count 904
PubMed Score 6460.00
PubTator Score 3956.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Duchenne muscular dystrophy 602 8.5e-11
juvenile dermatomyositis 1189 1.6e-10
ulcerative colitis 2087 9.5e-10
malignant mesothelioma 3163 1.1e-07
pilocytic astrocytoma 3086 1.2e-06
pediatric high grade glioma 2712 2.6e-06
lung cancer 4473 5.6e-06
limb girdle muscular dystrophy 2I 56 6.9e-06
glioblastoma 5572 7.9e-06
ovarian cancer 8491 1.4e-05
tuberculosis 1563 4.4e-05
uncontrolled asthma 67 1.0e-04
psoriasis 6685 2.0e-04
fascioscapulohumeral muscular dystrophy 100 2.6e-04
colon cancer 1475 4.2e-04
Becker muscular dystrophy 187 1.5e-03
pituitary cancer 1972 1.8e-03
Waldenstrons macroglobulinemia 764 2.2e-03
acute quadriplegic myopathy 1157 2.2e-03
autosomal dominant Emery-Dreifuss muscular dystrophy 499 2.3e-03
active Crohn's disease 918 4.7e-03
ependymoma 2514 5.8e-03
subependymal giant cell astrocytoma 2287 6.0e-03
astrocytic glioma 2241 7.1e-03
COPD 116 9.6e-03
pancreatic ductal adenocarcinoma liver metastasis 1795 1.3e-02
nephrosclerosis 329 1.6e-02
gastric carcinoma 832 1.7e-02
non diabetic and post-ischemic heart failure 200 1.8e-02
Down syndrome 548 2.1e-02
ductal carcinoma in situ 1745 2.3e-02
Rheumatoid Arthritis 1170 2.3e-02
non primary Sjogren syndrome sicca 840 2.5e-02
diabetes mellitus 1663 2.6e-02
intraductal papillary-mucinous adenoma (IPMA) 2956 2.7e-02
invasive ductal carcinoma 2950 3.0e-02
oligodendroglioma 2849 3.5e-02
dermatomyositis 966 3.8e-02
adrenocortical carcinoma 1427 4.0e-02
atypical teratoid / rhabdoid tumor 4369 4.7e-02

Expression

  Differential Expression (40)

Disease log2 FC p
Rheumatoid Arthritis 1.900 2.3e-02
nephrosclerosis 1.182 1.6e-02
Waldenstrons macroglobulinemia 2.302 2.2e-03
malignant mesothelioma -2.300 1.1e-07
astrocytic glioma 3.200 7.1e-03
ependymoma 4.200 5.8e-03
oligodendroglioma 2.700 3.5e-02
uncontrolled asthma 1.400 1.0e-04
psoriasis -1.300 2.0e-04
glioblastoma 3.300 7.9e-06
non diabetic and post-ischemic heart fai... -1.400 1.8e-02
atypical teratoid / rhabdoid tumor 1.500 4.7e-02
Duchenne muscular dystrophy 2.609 8.5e-11
autosomal dominant Emery-Dreifuss muscul... 2.025 2.3e-03
limb girdle muscular dystrophy 2I 1.987 6.9e-06
Becker muscular dystrophy 1.727 1.5e-03
fascioscapulohumeral muscular dystrophy 1.454 2.6e-04
juvenile dermatomyositis 1.945 1.6e-10
acute quadriplegic myopathy 1.285 2.2e-03
adrenocortical carcinoma -1.305 4.0e-02
tuberculosis -1.800 4.4e-05
pancreatic ductal adenocarcinoma liver m... 1.999 1.3e-02
intraductal papillary-mucinous adenoma (... -1.200 2.7e-02
lung cancer -3.700 5.6e-06
colon cancer 1.100 4.2e-04
active Crohn's disease 1.377 4.7e-03
ulcerative colitis 2.800 9.5e-10
diabetes mellitus -1.100 2.6e-02
pediatric high grade glioma 2.700 2.6e-06
pilocytic astrocytoma 2.900 1.2e-06
non primary Sjogren syndrome sicca -1.100 2.5e-02
subependymal giant cell astrocytoma 2.313 6.0e-03
invasive ductal carcinoma 1.074 3.0e-02
COPD -1.100 9.6e-03
gastric carcinoma 1.800 1.7e-02
ductal carcinoma in situ 1.200 2.3e-02
ovarian cancer -3.100 1.4e-05
pituitary cancer -2.200 1.8e-03
Down syndrome 1.900 2.1e-02
dermatomyositis 1.100 3.8e-02

Gene RIF (815)

PMID Text
26974151 lncRNA-uc002kmd.1 regulates CD44 as a molecular decoy for miR211-3p.
26897523 findings suggested that HIV-1 gp41-I90 ectodomain can enhance the transmigration of THP-1 through Cn-infected BBB, which may be mediated by CD44.
26823744 Maximal expression of CD44v6 in adenoma plays crucial role in colorectal carcinogenesis, while loss of CD44v6 expression enhances progression of metastasis. CD44v6 down-regulation is an independent prognostic factor for worse disease-specific survival.
26762850 High CD44 expression contributes to the development of carboplatin resistance in advanced serous epithelial ovarian cancer.
26708679 CD44 promotes chemoresistance in T-ALL by increased drug efflux.
26687806 the prevalence of ALDH1A3(+)/CD44(+) tumor cells in breast cancer is significantly associated with worse prognostic factors and favors a poor prognosis
26647656 we present evidence that CD44v3 immunoexpression and CD44v3+/CD24- immunophenotypes could give prognostic information associated with unfavorable clinical outcomes.
26639196 Suggest that CD44 is involved in the progression of precancerous gastric lesions in patients infected with Helicobacter pylori.
26621455 the gain of CD44v6 expression in premalignant and malignant colonic lesions suggests that CD44v6 may be functionally involved in the adenoma-to-carcinoma progression
26617909 CD44 polymorphisms are associated with chronic HBV infection as the risk factors
26617852 CD44(+)/CD24(-) phenotype may be an important factor for malignant relapse following surgical resection and chemotherapy in patients with invasive ductal carcinoma.
26608413 CD44 and CD133 might participate in early-stage endometrial cancer carcinogenesis
26597578 Peptide inhibitors of CD44v6 isoforms block tumor growth and metastasis in several independent models of pancreatic cancer.
26575878 The adhesion molecules CD62P and CD44 play an important role in the pathogenesis of bronchiolitis.
26552644 The combinatory expression of HOXA10 and CD44 was correlated with poor gastric cancer prognosis.
26540347 Nuclear CD44 in liver cancer stem cells is responsible for the poorly differentiated highly malignant tumor cells by maintenance of low stemness state.
26517627 CD44v9 positive cells also have a low mitotic activity and resist apoptosis
26449187 salivary gland mucoepidermoid carcinomas contain a small population of cancer stem cells with enhanced tumorigenic potential and that are characterized by high ALDH activity and CD44 expression
26429859 High CD44 expression is associated with lenalidomide resistance in myeloma.
26423339 CV-1 sensitively and specifically bound to CD44v on cancer cells and tissues.
26420348 CD44 expression pattern was significantly correlated with grade of dysplasia in ulcerative colitis
26418878 NDRG1 inhibits stemness of colorectal cancer via down-regulation of nuclear beta-catenin and CD44
26416034 The CD44 rs187116 genotype is associated with recurrence in gastric cancer, and the single nucleotide polymorphism was associated with CD44 isoform switching.
26408312 The expression of KAI1/CD82, CD44, MMP7 and beta-catenin is related to tumor metastasis and prognosis in colorectal carcinoma.
26356590 CD44 gene rs187115 polymorphism is a potential predictive marker of survival in NSCLC patients, and is significantly correlated with bone metastasis and tumor stage.
26299618 Ser291-phosphorylated form of the multifunctional protein and stem cell marker, CD44, inhibits FBXO21-directed degradation of P-gp.
26298632 Basal like tumors are enriched for cancer stem cells (CSC) with CD44(+)/CD24(-/low) phenotype. CD133 can detect a different population of CSC in breast carcinoma
26289026 ERM proteins contribute toward accelerated CD44 shedding by MT1-MMP through ERM protein-mediated interactions between their cytoplasmic tails.
26287771 High CD44 expression correlates with high Fuhrman grade, recurrence, microvascular invasion and poor prognosis.
26261555 CD44 expression was related to the distant metastasis and aggressive malignant behavior of pancreatic cancers.
26252284 This meta-analysis demonstrates that CD44v6 is associated with the metastasis of esophageal cancer and a poor prognosis, but is not associated with the histological types and tumor stages.
26250934 the peritoneal disseminated metastasis of epithelial ovarian cancer is initiated by the CD44v6-positive subpopulation, and CD44v6 expression is a biomarker for the clinical outcome of advanced ovarian cancer patients.
26218733 This study demonstrated that neuron density and chondroitin sulfate immunopositive area in the CA1 subfield are crucial for the hippocampal volume, and is important for the maintenance of a normal hippocampal volume in some cases with severe neuron loss.
26189059 CD44 increases aggressiveness in tumors through the process of vasculogenic mimicry.
26181364 Direct binding of CD44v6 to HGF and VEGF was demonstrated in pull-down assays
26151392 Our results indicate that the knockdown of hnRNP A1 has a specific function on the splicing of CD44 in breast cancer cells.
26134113 SFN inhibited invasion by activating ERK1/2 to upregulate E-cadherin and downregulate CD44v6, thereby reducing MMP-2 expression and activity. E-cadherin is an invasion inhibitor, while CD44v6 and MMP-2 are invasion promoters
26124272 E-selectin interactions with glycoprotein ligands (CD44/hematopoietic cell E-/L-selectin ligand and PSGL-1) mediate the initial capturing of cells out of flow.
26119931 we also demonstrated frequent co-overexpression and positive correlation of DARPP-32, SRp20 and CD44E expression levels in human gastric primary tumors.
26079799 the CD44-miR-199a-3p axis plays an important role in the development of metastasis, recurrence, and drug resistance of osteosarcoma.
26079538 Findings indicate that breast cancer cells with a hyperactive AF1q/TCF7/CD44 regulatory axis in the primary sites may represent "metastatic founder cells" which have invasive properties.
26077342 Employs CD44s to activate ZEB1 expression.
26067154 DLX4 induces CD44 by stimulating IL-1beta-mediated NF-kappaB activity, thereby promoting peritoneal metastasis of ovarian cancer
26025397 CD44 has important functions on the ability of Human umbilical cord mesenchymal stem cells to expand human hematopoietic stem cells in the cell-extrinsic control.
26010608 variant genotypes (CT and TT) of rs13347 of CD44 increased an individual's susceptibility to colorectal cancer, compared with rs13347CC homozygous genotypes.
25979842 these results indicate that biological changes induced by CD44 silencing are mediated by cumulative down-regulation of c-Jun, Sp1, and c-Src in human breast cancer cells.
25975956 CD44 mediates trastuzumab resistance in HER2-positive breast cancer cells independently of its role as a CSC marker and that this role of CD44 is partly regulated by miRNA.
25971596 CD44 mediates trastuzumab resistance in HER2-positive breast cancer cells independently of its role as a CSC marker and that this role of CD44 is partly regulated by miRNA.
25950774 Suggest that CD44 and CXCL9 may serve as predictive biomarkers to identify liver allograft recipients at risk for clinically significant acute graft rejection.
25937513 CD44S-hyaluronan interactions protect cells resulting from EMT against anoikis.
25929323 Ezrin, CD44, and VEGF are over-expressed in GCTB tissue and its adjacent noncancerous tissue samples and may play an important role in the occurrence, invasion, metastasis, and recurrence of GCTB.
25909162 The cleaved intracellular domain of CD44 activates stemness factors such as Nanog, Sox2 and Oct4. CD44 promotes tumorigenesis through the interaction and nuclear-translocation of its intracellular domain and these stemness factors.
25888636 Elevated tumor CD44 expression within the systemic circulation increases the efficiency of post-intravasation events and distant metastasis in vivo, consistent with increased distant recurrence and reduced disease-free survival in patients.
25886575 CD44s is modulated by c-Met and is involved in induction of tumor initiation in hepatocellular carcinoma.
25864644 CD44 knock-down in bovine and human chondrocytes results in release of bound HYAL2.
25850653 CD44v6 was able to differentiate epithelial from mesenchymal prostate cancer cells.
25840418 NGF-induced tyrosine kinase independent TrkA signaling through CD44 is sufficient to maintain tumor aggressiveness in breast cancer
25826491 E-cadherin and CD44 may have a role in the epithelial-mesenchymal transition of bladder urothelial carcinomas
25823654 Developing strategies to target CD44 may prevent metastasis, recurrence, and drug resistance in ovarian cancer.
25813380 Two identified candidate O-glycoprotein biomarkers (CD44 and GalNAc-T5) circulating with the STn glycoform were further validated as being expressed in gastric cancer tissue
25809603 findings support the value of CD44v6 as a possible indicator of poor outcome in patients with squamous lung carcinomas.
25809479 Interleukin-1beta has a role in reduction of CD44 Ser-325 phosphorylation in human epidermal keratinocytes that promotes CD44 homomeric complexes, binding to ezrin, and extended, monocyte-adhesive hyaluronan coats
25804234 Survival of patients with basal breast cancer was reliably higher at lack in tumors of cells with cancer stem cells markers CD44+/CD24- and, correspondingly, lower at presence of such cells (small er, Cyrillic < 0.05).
25791790 Increased Expression of CD44 mRNA is associated with Recurrence After Curative Resection of Hepatocellular Carcinoma.
25772760 TM4SF5-positive tumors exhibited locally-increased CD44 expression, suggesting tumor cell differentiation
25762343 We provide new insights into the close interplay between CD44 and HA and a potential biomarker to enrich patient responses to RG7356 in the clinic.
25737167 review focuses on CD44 prevalence in cancer cell. It considers tumorigenic behavior of cells that highly express CD44 as an early marker for neoplastic stem cell proliferation
25711649 a high expression of sCD44 is correlated with advanced stages of endometriosis. It is also concluded that the detection of serum and/or peritoneal fluid sCD44 may be useful in classifying endometriosis.
25710579 Prognostic Significance of CD44v6, CD133, CD166, and ALDH1 Expression in Small Intestinal Adenocarcinoma.
25708025 PRG4 is a novel putative ligand for CD44 and may control synoviocyte overgrowth in inflammatory arthropathies via a CD44-mediated mechanism.
25693083 higher level of CD44 expression in cancer cells correlated with lower Gleason score
25683728 FOXP3 directly binds to the promoter of CD44.
25683512 CD44-VCAM1 interaction mediates the adhesion between prostate cancer cells and HUVECs.
25681441 Ceramide limits CD44-dependent cancer cell migration, suggesting that ceramide nanoliposomes could be used to prevent and treat solid tumor metastasis.
25659582 SOD2-mediated antioxidant activity may restrict conversion of low CD44 expressing cells to high CD44 expressing cells at the early stages of epithelial-mesenchymal transition.
25658794 Expression of CD44, CD47 and c-met was upregulated in OCCC and pairwise correlation. CD44, CD47 and c-met may have synergistic effects on the development of OCCC and are prognostic factors for ovarian cancer.
25656929 fails to confirm the value of CD44 in differential diagnosis between prostatic SmCC and acinar adenocarcinoma
25656374 Down-regulation of CD44 that was overexpressed in resistant Lovo-1 cells with CD44 siRNA effectively decreased the viability of cells in combination with Y15.
25627085 TM4SF5 bound CD44, and the interaction regulated levels or activities of c-Src/STAT3/Twist1/Bmi1 to control the self-renewal properties of hepatocellular carcinomas.
25625240 Results show that CD44 and CD133 mRNA were highly co-expressed in colorectal cancer with hepatic metastases and that CD44 expression was an independent factor associated with patient survival.
25623890 Our results reveal that hnRNP L is a new regulator for CD44 V10 exon splicing
25605020 CD44 functions as an upstream regulator sensing the extracellular environment to modulate ERK, AKT and Hippo-YAP pathways which cooperatively control downstream gene expression to modulate breast cancer cell contact inhibition of proliferation.
25596560 Reversibly crosslinked hyaluronic acid nanoparticles with excellent biocompatibility, CD44-targetability, and effective reversal of drug resistance have a great potential in breast cancer therapy.
25582385 Increased expression of CD44 is associated with myelodysplastic erythropoiesis.
25576211 High CD44-SLC1A2 fusion transcripts are associated with primary colorectal cancer.
25571897 CD44s and CD44v6 appear to play opposing roles in the development of breast cancer.
25566991 This study sets the stage for CD44 and MT1-MMP as therapeutic targets in pancreatic cancer, for which small molecule or biologic inhibitors are available.
25551284 study defines a major metastasis and angiogenesis suppressive role for mir-34a, a microRNA functions as a tumor suppressor in bladder cancer by directly targeting CD44, which would be helpful as a therapeutic approach to block bladder cancer metastasis
25550556 CD44 expression in circulating colorectal cancer stem cells correlates with survival.
25515492 CD44 targeted HA-PEI/HA-PEG nanoparticle platform may be a clinicaly relevant gene delivery system for systemic MDR1 siRNA based anticancer therapies.
25483103 Data indicate that CD44 antigen CD44+ stem-like cells are responsible for mesenchymal transition and metastasis.
25481101 Upregulated expression of CD44v9 might contribute to the intractable nature of pancreatic cancer.
25479940 miR-328 downregulation and de novo expression of CD44v9 occurred in H. pylori-infected gastric mucosa adjacent to gastric cancer compared with gastric mucosa not infected with H. pylori adjacent to gastric cancer
25471937 The role of SMURF1 and inhibition of BMP signaling in maintaining a CSC-like population was confirmed by the loss of a CD44(high) expressing.
25461272 Studied effects of CD44 silencing on alterations in energy metabolism and sulfur-containing metabolites in vitro and in vivo using capillary electrophoresis-mass spectrometry and quantitative imaging mass spectrometry (Q-IMS), respectively.
25449226 define a role for TG2 activity at the surface of human macrophages in multiple stages of AC clearance and we propose that TG2, in association with heparan sulphates, may exert its effect on AC clearance via a mechanism involving the crosslinking of CD44
25447529 CD44 variant isoform (CD44v) but not CD44s regulates endothelial junction loss, promoting melanoma extravasation
25408361 Blocking PI3K/Akt pathway maybe necessary for anti-CD44 treatment on AML.
25400809 Increased expression of endogenous mature miR-199a might prevent the growth and migration of human cutaneous squamous cell carcinoma via decreasing the expression of CD44 and regulating the interaction between CD44 and Ezrin.
25400792 Case Report: undifferentiated colon carcinoma overexpressing CD44.
25369610 There is no change in soluble leucocyte selectin concentrations in whole blood after 48 hours of storage at 4 degrees C.
25339657 Expression of CD44 as a functional E-selectin ligand may be important in breast cancer metastasis.
25335738 CD44 could be a valuable tool for the study of lung CSCs and provide a novel therapeutic target for treatment of the patients with lung cancer in combination with conventional therapy.
25325984 transcriptional regulation of the HAS and HAS2-antisense RNA 1 genes, was analyzed.
25320329 Basic sequences in the cytoplasmic domains of PSGL-1, CD43, and CD44 are required for efficient association with HIV-1 Gag in HeLa cells
25301071 CD44 physically associates with LRP6 upon Wnt treatment and modulates LRP6 membrane localization.
25283845 upregulated in choriodecidua following labor
25277524 Manipulating GAPLINC expression altered CD44 mRNA abundance.
25269647 ZER suppressed EGF-induced CD44 expression through inhibition of the STAT3 pathway. Therefore, we suggested that ZER may act as a promising therapeutic drug for the treatment of breast cancer.
25268088 findings suggest that CD44 rs13347C>T and rs115214213T>C polymorphisms may affect naso-pharyngeal carcinoma development by improving CD44 expression
25194445 Gastric cancer patients with positive CD44 expression had a worse prognosis than ones with negative CD44 expression.
25184276 These findings provide not only new insight into the molecular mechanism underlying CD44 regulation but also potential therapeutic targets that may help eliminate chemo- and radiation-resistant cancer cells.
25169522 CD44v6 high expression as a poor prognostic factor for non-small cell lung cancer, and CD44v6 expression is associated with lymph node metastasis and histopathologic type.
25169209 CD44v6 is a potential melanoma brain metastasis-specific factor with theranostic utility for stratifying patients.
25168019 CD133, CD44, and CD90 could be used as prognostic and predictive markers in hepatoblastoma.
25143125 immunoreactivity cytokeratin 5 and CD44 commonly immunostained Nested/microcystic urothelial carcinoma (US) and some invasive high grade UC
25138157 CD44/selectin binding signals increased intercellular adhesion molecule 1 up-regulation on the endothelial cells (ECs)surface through a PKCalpha-p38-SP-1 pathway, which further enhances melanoma cell adhesion to ECs during metastasis
25138066 the relative expression of hyalurosome (CD44, HAS3, HB-EGF) genes was found to be reduced in patients prior to topical treatment and to be notably increased following treatment.
25129125 An increased expression of CD44 in endometrial cancer suggests its possible role in pathogenesis of this disease, however, it doesn't seem to be crucial.
25126764 The blockage of CD44 expression by siRNA resulted in the attenuation of IL-6 and chemokines expression in low molecular weight hyaluronan treated normal human dermal fibroblasts.
25123505 Expression of TNF-alpha and CD44 is implicated in poor prognosis, cancer cell invasion, metastasis and resistance to the sunitinib treatment in clear cell renal cell carcinomas.
25120740 Our meta-analysis showed that CD44-V6 is an efficient prognostic factor for non-small cell lung cancer
25116630 Terminal sialic acids on CD44 N-glycans can block hyaluronan binding by forming competing intramolecular contacts with arginine sidechains.
25101858 data are presented showing that CD44 could act through RhoA signaling to regulate YAP expression
25094049 CD166 affected-CD44 expression is dependent of transcription via blocking NF-kappaB pathway. On the contrary, CD44 promoted up-regulation of CD166 mRNA and protein.
25081533 analysis of the role of the Hyaluronan-CD44 interaction which oncogenic signaling, microRNA functions, chemoresistance, and radiation resistance in cancer stem cells [review]
25081532 CD44 integrates extracellular matrix cues with growth factor and cytokine signals [review]
25081531 review of the roles of HAS2 and CD44 in breast tumorigenesis [review]
25076245 Increased expression of CD44v3 may play a significant role in the carcinogenesis and progression of gastric adenocarcinoma. High CD44v3 expression may be a predictor of poor prognosis.
25064733 Studied the levels of soluble CD44 in cervical cancer patients by determining whether it consistently discriminates the carcinoma of the cervix from early or premalignant stage of the cervical cancer.
25060796 study reports osteopontin-CD44 functional interaction as a hallmark of early stages of calcific aortic valve disease; osteopontin-CD44 interaction mediates calcium deposition via phospho-Akt in valve interstitial cells from patients with noncalcified aortic valve sclerosis
25053293 A mesenchymal profile and expression of CD44, linked to activation of the TGFB pathway, may predict lack of response to sorafenib in hepatocellular carcinoma patients.
25031744 Our data indicate that expression of both CD44s and pSTAT3 in clear cell renal cell carcinoma is associated with advanced tumor stage and patient survival
25009318 the polymorphisms rs4754, rs9138 and rs1126772 of OPN gene and rs353639 of CD44 gene were significantly associated with gastric cancer.
24998585 High expression of CD44v3 is associated with the lymph node metastasis in squamous cell carcinomas of the uterine cervix.
24990559 These findings indicated that expression of CD44 drives iota toxin resistance through inhibition of endocytosis in breast cancer cells, a role not previously defined for CD44
24971320 CD44 rs187115 might be involved in CD44 isoform expression of p53 stress response in Hepatocellular carcinoma (HCC) and provide a marker for predicting worst-case prognosis of HCC.
24962319 CD44 transduces hyaluronic acid-based stiffness cues, temporally precedes integrin-based adhesion maturation, and facilitates invasion.
24960658 The In(a) frequency in this selected donor population was 1.3%.
24960044 Results show that camptothecin resistance status of colorectal cancer cells depend on the phosphorylation of TOP1 and the presence of CD44.
24920554 Results suggest that overexpression of CD133, CD44v6 and TF is associated with pancreatic carcinoma metastasis.
24916930 RHAMM may be implicated in severe ocular surface inflammation affecting the upper tarsal conjunctiva.
24912773 CD44 cytoplasmic tail cleaved by RIP could release DCAF1 from merlin by competing for binding to the merlin FERM domain, which results in the inhibition of merlin-mediated suppression of tumorigenesis.
24884875 The combined use of CD44 and ALDH widens the window for identification and targeting of a drug-resistant population which may improve the current treatment modalities in mesothelioma.
24864242 The goal of this study was to semiquantitatively detect presence of cancer stem cells markers CD44 and CD133 in immunohistochemically stained paired samples of colorectal cancer (CRC) and colorectal liver metastases.
24860093 the hyaluronan receptor CD44 interacts with both PDGFRbeta and TbetaRI.
24839953 High CD44/CD133 expression is an independent prognostic factor for disease-free survival in pancreatic ductal adenocarcinoma.
24832177 During cancer progression there is a loss of expression of all CD44 variants, and higher expression of CD44v2 correlates with a better recurrence-free survival rate.
24823486 Activation of c-Met and upregulation of CD44 expression are associated with the metastatic phenotype in the colorectal cancer liver metastasis model.
24739401 Results suggest that rituximab has significantly decreased the prognostic value of CD44H.
24739387 P6 is a novel sequence in PEX9 involved in cell-PEX9/(pro)MMP-9 binding by interacting with CD44.
24727741 This study suggests the possibility that EpCAM, together with CD44v6 and claudin-7 as well as ALDH1, may be involved in the development of the aggressive phenotype of anaplastic thyroid carcinoma.
24726313 Our results suggest that CD44v6 total RNA levels in urine can serve as a potential noninvasive biomarker of bladder cancer.
24716927 A high level of CD44 expression was found.
24716905 CD44 v6 and E-cad expressions had a significant correlation in the NSCLC tissue with lymphatic metastasis.
24715151 In the present study, we verified that MCF-7 cells subjected to drug pressure develop multidrug resistance to doxorubicin, and the expression levels of multidrug resistance protein 1 (MDR1), CD44st and nuclear factor-kappaB (NF-kappaB) mRNA
24709425 Interactions between CD44 expressing breast cancer cells and soluble factors present in the lung microenvironment may play an important role in determining organotropic metastatic behavior.
24708709 CD44v6+, CD44v9+ and CD44s- were associated with pancreatic carcinoma metastasis and progression and that CD44v6+/CD44s- was an independent risk factor affecting survival in pancreatic carcinoma.
24699672 CD44 rs187115 polymorphism has potential predictive significance in oral carcinogenesis and also may be applied as factors to predict the clinical stage in OSCC patients
24680978 Results indicate that among investigated single nucleotide polymorphisms (SNPs), only CD44 rs13347 has an impact on the efficacy of HSCs mobilization in patients with hematologic malignancies.
24655565 we find that CD44, which is involved in mesothelioma cells migration, was modulated by exemestane via cAMP and pCREB
24647926 High CD44 expression is associated with hepatocellular carcinoma.
24647137 HIF-1alpha/PTEN/CD44v6/Survivin, as measured by immunohistochemistry, can be used to predict the prognosis and potential for invasion and metastasis in Asian patients with gastric cancer.
24631171 CD24/CD44/CD47 are differentially expressed in cells of urothelial BCa in patients undergoing RC and influence cancer-specific survival of patients
24619956 The study shows that autocrine fibroblast growth factor 18 signaling mediates Wnt-dependent stimulation of CD44-positive human colorectal adenoma cells.
24618343 CD44v8-10 marks human gastric cancer stem cells and contributes to tumor initiation.
24614402 Knock-down of CD44 resulted in an upregulation of mRNA expression of the chemokines CXCL9 and CXCL12, as well as their receptors CXCR3 and CXCR4.
24607407 The CD44 ligand osteopontin shared a perivascular expression pattern with CD44 and promoted glioma stem cell-like phenotypes.
24607406 The metastatic process in colorectal cancer is initiated by cancer stem cells through the expression of CD44v6, which is both a functional biomarker and therapeutic target.
24606718 HA/CD44-induced c-Jun signaling plays a pivotal role in miR-21 production leading to Bcl-2 upregulation and chemoresistance in triple negative breast cancer cells
24604526 CD44 dysregulated the activation of the Fra1 gene. The interaction of Fra-1 and CD44 may therefore be important in cervical carcinoma.
24583847 Data show that VCAM-1 (CD106) physically associates with CD44 antigen.
24526308 regulatory factor 1 directly regulates CD44 expression in glioblastoma
24512624 The results support a novel mechanism whereby CD44 palmitoylation and consequent lipid raft affiliation inversely regulate breast cancer cell migration, and may act as a new therapeutic target in breast cancer metastasis.
24504189 CD44v6 or ABCG2 positivity in NAC-treated patients was significantly associated with tumor local recurrence.
24491153 High CD44s and low CD44v6 expression may be an independent predictor of improved survival in malignant fibrous sarcomas patients
24482053 High expression of CD44 is associated with vascular invasion in intrahepatic cholangiocarcinoma.
24468288 CD44v6 expression, serum prostate-specific antigen level, and surgical margin status appeared to be independently associated with biochemical recurrence of prostate neoplasms on multivariate analysis
24455718 we demonstrated via antibody blocking experiments that aV b5 and a6 significantly promoted hESC attachment in 2%oxygen only, whereas blockage of CD44 inhibited cell attachment in 21% O2 alone
24450601 study found that ALDH1, CD44, OCT4 and SOX2 are overexpressed in tongue squamous cell carcinoma
24434427 CD44 regulates the metastasis of breast cancer cells through regulating NHE1 expression, which could be used as a novel strategy for breast cancer therapy.
24434386 Report CD44 expression in renal cell carcinoma subtypes.
24429392 CD44 expression is associated with tumor size, lymph node metastasis, and poor prognosis in pharyngolaryngeal cancer patients [review and meta-analysis]
24410905 Meta-analysis/Review: CD44 is related to worse T category, N category, tumor grade and prognosis, in pharyngeal and laryngeal cancer, but no clear association was revealed between CD44 expression and oral cancer.
24406795 All hMSCs expressed high levels of HAS1-3, secrete large amounts of HA, and surround themselves with a thick HA coat bound to CD44.
24403253 ADAM17-mediated CD44 cleavage promotes orasphere formation or stemness and tumorigenesis in head and neck squamous cell carcinoma.
24397969 CD44s is up-regulated in human pancreatic tumors and associated with patient survival time. CD44s is required for initiation, growth, metastasis, and postradiation recurrence of xenograft tumors in mice.
24366074 A CD44 positive/CD24 negative/low profile correlates with more aggressive clinical-pathological features of breast cancer.
24363164 CD44 and CD24 cannot be considered potential markers for isolating lung CSCs in cell line A549, but further investigation using in vivo assays is required.
24333422 We have also found out that CD44v8-10 expression is associated with the turn-over of the c-Myc with the experiments using gastric cancer cell lines.
24324613 Rb suppresses collective invasion, circulation and metastasis of breast cancer cells in CD44-dependent manner.
24324260 c-Met and CD44v6 receptors have roles in autocrine TGF-beta1 signaling in interstitial lung disease
24318997 macrophages in the tumor microenvironment may cause increased CD44 expression through miR-328 suppression, resulting in tumor progression by enhancing ROS defense.
24300972 CD44s symbolises the acquisition of a mesenchymal phenotype regulating anchorage-independent capacity.
24276281 CD44 expression appears to be a significant prognostic marker in early stage patients and may be useful in determine long-term outcomes.
24194636 Soluble CD44 increases outflow resistance in vivo and in vitro.
24186075 This study reports an important role of CD44 haplotypes with reduced risk of gallbladder cancer
24173428 the V6 exon and flanking introns of CD44 pre-mRNA contain SC35 response elements that regulate V6 splicing.
24167614 TNBC was significantly associated with PTEN loss, high Ki67 and the CD44+/CD24- phenotype. The loss of PTEN impacts DFS significantly in African Americans.
24157443 These results indicate that parasite-invaded leukocytes gain higher ability to adhere to hyaluronan than non-invaded leukocytes, via upregulation of CD44 expression and/or selective invasion to CD44 highly expressing cells.
24156023 patients with HPV(DNA+) and absent/weak CD44 intensity OSCC presented the best survival and this marker combination could possibly be used for selecting patients for tailored deintensified treatment in prospective clinical trials.
24132924 We identified HAb18G/CD147 as a novel upstream activator of STAT3, which interacts with CD44s and plays a critical role in the development of pancreatic cancer.
24122205 the expression of CD44 and its variants was assessed in head and neck squamous cell carcinomas
24099991 HAS1-dependent coat is induced by inflammatory agents and glycemic stress, mediated by altered presentation of either CD44 or hyaluronan, and can offer a rapid cellular response to injury and inflammation
24091662 CXCL12-induced CXCR4 signaling depends on the binding of high-molecular-weight hyaluronic acid to CD44.
24084461 Poor prognosis for serous ovarian cancer patients with CD44(+)/E-cadherin(-) and CD44(+)/budding(+) tumor cells phenotype, has been revealed
24069351 Hyaluronan-CD44 interaction promotes growth of decidual stromal cells in human first-trimester pregnancy.
24064218 a novel signaling axis, i.e., ROCK-JNK-ETS-1-CD44 pathway, which plays an essential role in the S1P3-regulated chemotactic response.
24038513 Findings suggest that rs13347C>T in 3'UTR of CD44 may be a genetic modifier for developing acute myeloid leukemia.
24019906 colony forming efficiency of CD44(hi) cells, characteristic property of CSC, can be inhibited by mir-34a replacement in these samples
24019861 observed that the expression of COX-2, CD44v6, and CD147 were significantly associated with T classification, lymph node metastasis and clinical stage
24010665 CD44 receptor unfolding enhances binding by freeing basic amino acids to contact carbohydrate ligand
24009708 CD44 expression in intestinal epithelium and colorectal cancer is independent of p53 status.
24005673 Data indicate that TSG-6-mediated cross-linking of hyaluronan (HA) films is impaired in the presence of inter-alpha-inhibitor (IalphaI) and that this effect suppresses the TSG-6-mediated enhancement of HA binding to CD44-positive cells.
24004467 CD44v6 and integrin-beta1 mRNA and protein expression in blood may serve as biomarkers for the development and metastasis of pancreatic cancer.
23964856 The suppression of Notch-1 led to increased expression of Oct4 and Sox2, but in decreased gene expression of cMET, Setmar and CD44.
23940692 The CD44 rs353639 genetic variants may have significant effect in breast cancer prognosis.
23900701 Ezrin and CD44 co-expression was highly expressed in neoplastic stem cells and may be a potential biomarker for initiation, progression and differentiation of breast cancer tumors.
23889297 Moesin expression and CD44 expression might be useful markers of poor prognosis in gastric adenocarcinoma.
23888049 malignant breast cancer cells are heterogeneous in their expression of surface-associated CD147 and that high levels of membrane CD147 correlate with cell surface EGFR and CD44 levels, activated EGFR and ERK1, and activated invadopodia.
23884413 release of the CD44 intracellular domain into the cytoplasm of cells such as chondrocytes exerts a competitive or dominant-negative effect on the function of full-length CD44.
23883608 CD44 rs13347C>T polymorphism may affect nasopharyngeal carcinoma development by improving CD44 expression.
23874603 Basic sequences in the cytoplasmic domains of PSGL-1, CD43, and CD44 are required for efficient association with HIV-1 Gag in HeLa cells
23856463 CD44 increases phorbol ester-induced expression of p21WAF1 by stabilizing its mRNA and extending protein half-life
23848514 Development of CD44v9+ gastric cancer in humans was significantly associated with the presence of spasmolytic polypeptide-expressing metaplasia in the region adjacent to the tumor.
23837451 In hypopharyngeal carcinoma, CD44+ cells have higher tumorigenic potential than CD44- cells.
23835592 CD44/CD24 as potential prognostic markers in node-positive invasive ductal breast cancer patients treated with adjuvant chemotherapy.
23803658 results indicate that CD44 plays a role in the EMT phenotype of CSCs in NPC, and suggest its involvement in EMT-associated ROS production.
23800986 CD44 variant exon 9 plays an important role in colon cancer stem cells.
23797812 CD44 is a valid undifferentiated malignant squamous cell marker.
23778530 CD44 variant 9 expression represents a potential predictive marker for recurrence in endoscopic submucosal dissection of gastric cancer.
23768762 findings suggest that CD44+SSEA-4+ cells exhibit the characteristics of CSCs in oral squamous cell carcinoma and provide a target for the development of more effective therapie
23764310 TFAP2C repressed CD44 expression in basal-derived breast cancer.
23744486 Data suggest that detection of ductal carcinoma in situ (DCIS) based on marker expression during breast conserving surgery should be possible with a panel of molecular imaging tracers targeting CD44v6, GLUT1, HER2, IGF1-R, and EGFR.
23736812 DNA from 4 HPV positive and 4 HPV negative fresh frozen primary HNSCC were subject to comprehensive genome-wide methylation profiling.Pathway analysis of 1168 methylated genes showed 8 signal transduction pathways (Cd44)of which 62% are hypermethylated.
23685894 Up-regulation of both MMP-2 and CD44v6 is significantly correlated with the development of lateral cervical lymph node metastasis in patients with papillary thyroid carcinoma.
23681900 CD44/cellular prion protein interaction is associated with multidrug resistance in breast cancer.
23679813 CD44(+) /CD24(+) /EpCAM(+) expression was not correlated with patient outcome.
23667174 RBM3 greatly attenuates the stem cell-like properties of prostate cancer cells by inhibiting alternative splicing of exon v8-v10 of CD44.
23665041 Hepatic stellate cell-induced development of CD14(+)HLA-DR(-/low) myeloid-derived suppressor cells was not mediated by soluble factors, but required physical interaction and was abrogated by blocking CD44
23664487 CD44 standard form expression is correlated with high-grade and advanced-stage ovarian carcinoma but not prognosis.
23653392 CD10 might be involved in the development of endometriosis due to its influence on CD44-dependent cell adhesion.
23645762 High CD44 expression is associated with intrahepatic cholangiocarcinoma.
23633482 Involvement of CD44-expressing cancer stem cells in the development of bone metastases through interaction with hyaluronan.
23609373 Found that high expression of CD44 and CD133 were closely associated with malignant phenotypic features and/or poor prognosis of gastric cancer patients.
23603511 Report CD44/macrophage mannose receptor as a ligand/receptor pair involved in the process of lymphocyte transit via the lymphatic vasculature.
23600676 Real-time RT-PCR assays detected increased expression of CD44, but not CD24, in saliv-ary gland pleomorphic adenoma specimens in comparison with normal salivary gland controls.
23589310 an in vivo signaling pathway, ERK --> CD44 --> STAT3, that regulates normal and atrophy-induced gastric stem/progenitor-cell proliferation.
23589287 HAS2-dependent production of HA facilitates TGF-beta1-dependent fibroblast differentiation through promoting CD44 interaction with EGFR held within membrane-bound lipid rafts.
23565227 94 of 100 in: PLoS One. 2013;8(4) (dup#21) Silencing of CD44 gene expression in human 143-B osteosarcoma cells promotes metastasis of intratibial tumors in SCID mice.
23553902 This study demonstrates that the cluster of differentiation genes CD24 and CD44 are differentially expressed across LGR5 positive "active" stem cells as well as HOPX positive "facultative" stem cells.
23549458 CD44v6 may be a biomarker of arsenic-induced neoplastic transformation in human skin cells
23547049 CD44 expression in chronic lymphocytic leukemia is mediated by the tumor microenvironment. As a coreceptor, CD44 promotes leukemogenesis by regulating stimuli of MCL1 expression.
23536680 Basic sequences in the cytoplasmic domains of PSGL-1, CD43, and CD44 are required for efficient association with HIV-1 Gag in HeLa cells
23476138 MMP9 knockdown increases expression of CD44v6 in PC3 cells.
23463035 Case Report: atypical fibrous histiiocytoma positive for CD163/CD44.
23457460 FKBPL and and its peptide derivative, AD-01 regulate expression of CD44.
23449937 Our results indicate that signaling triggered by HA-CD44 interaction significantly contributes to HA-induced chondrogenesis and may be applied to adipose-derived stem cell-based cartilage regeneration.
23445749 Report prognostic value of CD44 overexpression in neuroblastic tumors.
23444222 Data indicate that low mRNA expression levels of CD44 and orthopedia homeobox (OTP) and high levels of RET, were strongly associated with a low 20-year survival of carcinoid patients.
23435135 Simultaneous overexpression of CD44 and c-erb-B2 may be used as a marker of poor prognosis in gastric carcinoma.
23426175 SPHK1 contributes toward the regulation of CD44 protein expression through the ERK signaling pathway in human colon cancer cells.
23422486 No compensation in CD44 stem cell marker occurs following BCL-2 suppression by antisense oligonucleotides.
23419168 Analysis of CD44/CD24 immunoexpression could give prognostic information associated to clinicopathologic features in salivary glands malignant neoplasms.
23404221 The knockdown of CD44v6 decreased vimentin expression, cell invasion and HGF-induced cell migration, but conferred only a slight effect on E-cadherin expression in colon cancer cells
23373240 Expression of OPN, CD44v6 and MMP-9 are positively related and involved in the invasion and metastasis of laryngeal squamous cell carcinoma.
23342032 a possible role of CD44 in tumour progression
23334333 Cancer stem cells, in which defense against reactive oxygen species is enhanced by CD44v, are thought to drive tumor growth, chemoresistance and metastasis. [Review]
23333304 Basic sequences in the cytoplasmic domains of PSGL-1, CD43, and CD44 are required for efficient association with HIV-1 Gag in HeLa cells
23326564 The present study identifies STAT3 as an important signaling molecule interacting with CD44 and demonstrates the essential role of CD44-STAT3 signaling in breast cancer invasion.
23314380 Through the inhibition of CD44 expression levels, miR-34a plays a significant role in the migration and invasion of osteosarcoma cells.
23283480 CD44 in articular cartilage is associated with progressive knee osteoarthritis joint damage.
23265944 CD44 therapy in HNSCC may target the CSC population and alter EGFR signaling
23263849 The expression of CD27 together with CD44 showed a relationship with several established risk factors as well as response to therapy, indicating the biological significance of these molecules in acute lymphoblastic leukemia
23252868 levels of CD133, CD44, and ALDH1 had independent prognostic value to predict the recurrence of lung adenocarcinoma
23251004 These results suggest that the OPN-CD44 interaction is important for colorectal cancer progression and could serve as a potential therapeutic target for the treatment of colorectal cancer.
23238743 High CD44 expression is asscoiated with agressive recurrence of hepatocellular carcinoma.
23226410 Trans-acting factor binding sites and nuclear factors AP-1 and NFkappaB that are involved in the regulation of cell-specific CD44 expression, are reported.
23221384 Moesin is a glioma progression marker that induces proliferation and Wnt/beta-catenin pathway activation via interaction with CD44.
23220849 Report immunohistochemical CD44 expression in hyperplastic and neoplastic lesions of the prostate gland.
23171677 High frequency of ovarian cancer stem cells (CD44+ and CK19+) in epithelial ovarian tumors correlates with short progression-free intervals.
23170789 PAR2-AP or FVIIa elicited time-dependent downregulation of caspase-3, and up-regulation of MMP-9 and CD44 in SW620 cells.
23169460 increased CD44 expression was associated with even worse survival in patients with chemoresistance and with lung metastases.
23160198 Apoptotic microparticles bound to and inhibited dendritic cells through the hyaluronate receptor CD44.
23151220 Particular CD44 variant isoforms seem to act as "metastasis genes" via tumour microenvironment-driven shifts in v3 and v6 expressions.
23143465 CD44 is expressed in intraoral salivary ductal papillomas and oral papillary squamous cell carcinoma.
23138176 Studies indicate that dual CD44+CD117+ cells were markedly more tumorigenic than their negative counterparts.
23118219 The effects of high and low molecular weight hyaluronan on CD44 clustering, were investigated.
23112116 Medullary and metaplastic carcinomas are the two types highly associated with high-grade breast carcinomas, basal-like and claudin-low molecular subtypes, and to the breast cancer stem cell phenotype CD44(+)/CD24(-/low)/ALDH1(+).
23098472 High CD44v6/v7 expression is associated with acute promyelocytic leukemia.
23089492 Neither CD44H nor CD44v6 scores correlated with the osteopontin expression score or Ki-67 index. Osteopontin immunoexpression was highest in PCNSL, suggesting its probable role in its pathogenesis.
23071680 Data indicate that resistance to UVB induced apoptosis in the alpha6 integrin(high+)/CD44(+) cells involved increased expression of TAp63 and was overcome by PI-3 kinase inhibition.
23056168 Data indicate that PDGF enhances the adhesion of CD44v-coated beads to immobilized fibrin(ogen).
23049743 A CD44high/EGFRlow subpopulation within head and neck cancer cell lines shows an epithelial-mesenchymal transition phenotype and resistance to treatment.
23039365 Data suggest that CD44 may present an important determinant of breast cancer progression in the setting of endocrine resistance.
23031255 Lipid rafts regulate interactions between CD44 and its binding partner ezrin in migrating breast cancer cells.
23028444 our results support the strong clinical relevance of the CD44+/CD24- subclass of breast cancer cells.
23002207 Data suggest that the transition from CD44(-/low) to CD44(high) state helps to maintain a CD44(high) fraction and the tumorigenic diversity in colon cancer.
22972620 CD44 levels and patterns of expression can be considered as markers for penile squamous cell carcinoma aggressiveness.
22969228 The lack of membranous CD44v6 in the rectal cancer invasive front could be used as a method to identify patients at increased risk for recurrent disease.
22967445 Ezrin, E-cadherin and CD44V6 play an important role in the regulation of growth and meastasis of lung cancer.
22966907 CD44 signaling regulates phosphorylation of RUNX2. Localization of RUNX2 in the nucleus requires phosphorylation of Smad-5 by integrin alphavbeta3 signaling.
22947857 biophysical parameters and molecular constituents of CD44 binding to hyaluronan and fibrin(ogen)
22932199 The increased expression of CD44v6 and Livin in gastric cancer tissue may be closely related with development and progression of gastric cancer.
22923171 it is likely that active MMP-9 and ADAM10 help regulate the cellular levels of CD44v6 through cleavage of CD44v6 ectodomain during tunicamycin-induced apoptosis of Caki-2 cells.
22923071 LGR5 and CD44 expression may be coordinately associated with tumor relapse in locally advanced rectal cancer after preoperative chemoradiotherapy (CRT).
22922740 study identified a new function of hyaluronan (HA)in induction of MT1-MMP expression in breast cancer cell lines and CD44 cleavage to increase cell migration during invasion process; HA oligosaccharide-induced MT1-MMP expression in breast cancer cells may be a critical step in the formation of metastatic colonies
22901285 samples represent a tumor-initiating cells (TICs) subset which may be either M- or S-type, and which is separate from the CD44(high)/Oct-4A(high) subset observed only in M-type samples.
22895075 A3D8 induces apoptosis in leukemia cells through caspase-8 activation by binding to CD44s protein.
22870202 Both CD44 and CD147 enhance metastatic capacity and chemoresistance of CaP cells, potentially mediated by activation of the PI3K and MAPK pathways.
22865879 the interaction of hyaluronan in vitreous and CD44 modulates transgene expression by initiating CD44 proteolysis and release of the cytoplasmic domain, resulting in increased transgene transcription.
22855175 +/CD24- breast cancer stem cells have substantial pro-angiogenic potential and activi
22847005 Hyaluronan-CD44v3 interaction with Oct4-Sox2-Nanog promotes miR-302 expression leading to self-renewal, clonal formation, and cisplatin resistance in cancer stem cells from head and neck squamous cell carcinoma.
22843930 Loss of CD44s immunolabelling in colorectal carcinoma is an independent favourable predictor of regional lymph node metastasis. On the other hand, CD44s loss has no significant association with disease recurrence or survival.
22842095 Studies indicate that CD44 and CD133 as cancer stem cell markers in head and neck squamous cell carcinomas.
22839505 Neither individual expression of CD24 or CD44, nor combined expression of CD44/CD24 was associated with recurrence of gastric carcinoma.
22836803 High expression of CD44 is associated with colon cancer.
22807608 OPN plays a significant role in the proliferation of hepatocellular carcinoma through interaction with the cell surface receptor CD44
22804494 Cytoplasmic CD44 and absence of nuclear Oct3/4 suggest that the cells of cardiac sarcomas may represent 'daughter' stem cells that no longer have the capacity for tumour initiation, but have subsequently developed new lines of partial differentiation.
22788972 These findings suggest that CD44 rs13347C>T polymorphism may affect breast cancer development and prognosis by increasing CD44 expression.
22784357 CD44v6 was not a predictive factor in endometrioid cancer
22770970 CD44 mediated signaling may be implicated in Epstein-Barr virus infection associated with the pathogenesis of oral squamous cell carcinoma and nasopharyngeal carcinoma.
22753277 expression of hyaluronan (HA) and CD44 in 278 breast cancer cases, half of which were HER2-positive was studied; CD44 positivity in carcinoma cells was related to poor differentiation, postmenopausal status and triple negative breast carcinoma
22740326 The data demonstrated that metastatic properties of cell populations from blood and liver metastasis, differently from primitive tumors, seem to be strictly related to the phenotype CD133 positive and CD44 positive.
22740085 Combination of CD29 and CD44 can be used as markers to enrich cancer stem cells in human squamous cell carcinoma with epithelial-mesenchymal transition.
22733437 Results show that the cellular receptors, FAK, CD44v6, c-Met and EGFR, are biomarkers of survival and tumour progression in colorectal cancer. Increased staining for each receptor was also followed by expression elevation of at least one other marker.
22726066 CD44 expression levels correlated with the histopathological grade of gliomas, and monoclonal anti-CD44 antibody inhibited the migration of glioblastoma cells.
22711991 LRP-1--CD44 is a new cell surface complex regulating tumor cell adhesion
22706704 The CD44 gene expressions in the non-tumor tissues may predict hepatocellular carcinoma recurrence.
22673910 Alternative splicing of CD44 mRNA by ESRP1 enhances lung colonization of metastatic cancer cell.
22673507 In HCC patients, the expression of THAP11 mRNA significantly correlated with PCBP1 mRNA expression. Our results suggest a novel role of THAP11 in CD44 alternative splicing and hepatoma invasion
22654106 bone marrow mesenchymal stem cells (MSCs) physiologically lack expression of CD44, highlighting the natural phenotype of MSCs
22637644 The 3' UTR of CD44 induces metastasis by regulating extracellular matrix functions.
22621373 Hyaluronan-induced CD44 signaling increases a diverse spectrum of protease activity to facilitate the invasion associated with Basal-like breast cancers cells, providing new insights into the molecular basis of CD44-promoted invasion.
22610780 the CD44+/CD24- phenotype in ovarian cancer cells demonstrate cancer stem cell-like properties of enhanced differentiation, invasion, and resistance to chemotherapy.
22606006 amplification of ERBB4, C-MET and CD44 was significantly associated with certain clinicopathological characteristics, particularly tumor differentiation and cancer-related death and poor survival.
22559040 The authors report statistically significant correlation between CD44s and CD44v6 expression and increasing grade and stage of transitional cell bladder carcinoma.
22552741 CD44 downregulated E-cadherin expression, upregulated N-cadherin, alpha-actin, vimentin, fibronectin and MT1-MMP, and inhibited the formation of the membrane-associated E-cadherin-beta-catenin complex, which resulted in cell invasion and migration.
22552294 findings suggest that CD44s plays a critical role in the TGF-beta-mediated mesenchymal phenotype and therefore represents a potential therapeutic target for HCC
22525501 CD44v6 over-expression presents a positive correlation with hepatocellular carcinoma metastatic potential.
22514625 Non-sphere-forming Epcam+CD44- cells induced significantly more prostate tubular structures than Epcam+CD44+ sphere-forming cells.
22499789 CD44 is expressed in inflammatory cells in obese adipose tissue, and serum CD44 levels are positively correlated with insulin resistance and glycemic control
22493711 Gene expression signature of the transcription factor SNAI2 and the putative stem cell marker CD44 are strongly correlated and highly expressed in glioblastomas versus lower grade gliomas.
22491449 The enhancement of IP-10 production upon stimulation with TLR2 ligands in cells replicating hepatitis C virus induced CD44 expression.
22473523 Suppression of HAS 2 expression resulted in CD44-dependent decreased tumor cell migration, decreased tumor cell growth, and increased cisplatin sensitivity
22456539 stretch-induced CD44v7 over joints, in concert with dysregulated osteopontin levels in the skin of dermatomyositis patients, increases local inflammatory cell recruitment and contributes to the pathogenesis and resistance of Gottron's papules.
22449225 CD44 and activated T cell infiltration play an important role in the development of plexiform lesions particularly in idiopathic pulmonary arterial hypertension.
22433859 Identification of function for CD44 intracytoplasmic domain (CD44-ICD): modulation of matrix metalloproteinase 9 (MMP-9) transcription via novel promoter response element.
22429811 Data suggest that pulmonary metastasis is corrected with levels of Geminin, cleaved caspase-3, CD44, E-cadherin, epidermal growth factor receptor, and CD204 in cancer cells within permeated lymphatic vessels.
22389315 P-cadherin is coexpressed with CD44 and CD49f and mediates stem cell properties in basal-like breast cancer.
22386367 These data indicate important role of CD44 molecule in breast cancer (BC) pathology; TNF-a differentially modulates the expression of CD44 in BC cells, affecting their in vitro migration
22363471 This investigation has enhanced understanding of cell invasion and confirmed CD44 to play a more significant role in this biological process than CD155.
22335271 Analysis of pancreatic adenocarcinoma tissue microarrays showed that CD24 was significantly associated with late-stage pancreatic adenocarcinomas, and RPN2 was exclusively coexpressed with CD24 in a small population of CD24-positive cells.
22322379 The epithelial-mesenchymal transition (EMT) correlated with CD24+CD44+ and CD133+ cells in pancreatic cancer.
22321833 The results indicated that heparin/HS/CD44-v3-mediated signaling, in the absence of growth factor networks, enhances the direct repair of the damaged trophoblast layer through the migration of trophoblast cells.
22307465 Demonstrate that the use of CD44v6 targeting antibody fragments improves radioimmunotargeting and possibly the management of head and neck malignancies.
22293754 It was found that CD44 (a cell surface marker for cancer stem cells) interacts with pyruvate kinase M2 and thereby enhances the glycolytic phenotype of cancer cells that are either deficient in p53 or exposed to hypoxia.
22278305 Report disturbed interplay between hyaluronan and its binding protein CD44, and an obvious increase and displacement of MMP3/9 in skin of psoriatic arthritis patients.
22272243 Data indicate that CD44R1 is an excellent molecular target for mAb therapy of cancer.
22271686 Together, these findings reveal a CD44-CREB signaling pathway that is needed to sustain cancer cell proliferation, potentially offering new molecular targets for therapeutic intervention in thyroid carcinoma.
22270319 The SCLC cell lines showed the lowest CD44 expression on the cell surface and lowest number of adhesive events.
22266115 It was found that elevated expression of fatty acid synthase is associated with advanced stages of colorectal cancer and liver metastasis. Targeted knockdown of fatty acid synthase abolished CD44 expression.
22242150 Bioinformatic processing of large numbers of global gene expression analyses demonstrated elevated CD44 expression in head and neck cancer.
22237177 Regarding the correlation of CD44/CD24 status with tumor characteristics, the tumors of group A were significantly associated with axillary lymph node metastasis compared with those of group B (p = 0.033).
22218639 Hyaluronic acid cannot affect the CD44 mRNA expression in osteoarthritis fibroblast-like synoviocytes.
22216242 data suggest that vimentin provides a specific binding site for soluble CD44 on endothelial cells
22213301 High CD44 is associated with tongue cancer.
22205660 These results suggest that genetic polymorphisms in the TLR3 and CD44 genes are associated with the persistence of the immune response to serogroup C meningococcal vaccines 1 to 6 years after vaccination.
22152097 Knockdown of CD44 is an effective strategy for attacking the stemness of breast cancer stem cells.
22135720 nestin and CD44 are significantly expressed in a subset of gastric adenocarcinoma
22130902 Increased expression of CD44, CD166 and CD133 from normal mucosa samples to adenoma and carcinoma was linked to tumor progression in tumors of the ampulla of Vater.
22125838 In gastric carcinoma, The increasing of CD44 protein indicated that it may play an important role in the occurrence, development and metabasis of gastric cancer.
22119938 CD24 and CD44 expression can individually yield prognostic data in breast cancer, but importantly, when both markers are considered; the CD44(+)/CD24(-) phenotype had the best prognosis, while the CD44(-)/CD24(+) phenotype had the worst prognosis.
22119814 CD44 has limited utility in identifying oral cancer stem cells, while CD117 and CD133 expression appears to be limited more in identifying mesenchymal stem cells.
22076958 Our results show that CD133 and CD44 are universally expressed in gastrointestinal stromal tumors, and may represent a lineage rather than a cancer stem cell marker
22072421 CD44 retains hyaluronan in the keratinocyte pericellular matrix, a fact that has not been shown unambiguously before, and that hyaluronan abundance in the absence of CD44 can result in hyaluronan trapping in abnormal locations possibly interfering there with normal differentiation and epidermal barrier function
22069487 CD44 upregulation is associated with invasion in esophageal cancers.
22068886 ycoengineering of HCELL, the human bone marrow homing receptor: sweetly programming cell migration.
22048598 Among CD44s and its variant isoforms,v5, v6, in this study, variant isoform v6 may serve as a marker in detecting high-risk leukoplakias.
22024057 CD44 was indicated to be strongly related to cancer progression via an increase of cellular proliferative potential.
22021370 Studies indicate that PSGL-1, CD44, and ESL-1 on mature leukocytes are physiologic glycoprotein ligands for endothelial P-selectin and E-selectin.
22014860 study demonstrated that invasive micropapillary carcinoma represents a distinct entity of breast carcinoma with reduction of CD44 isoforms v5 and v9, compared to invasive ductal carcinomas
21993315 CD44 activation upregulates the anti-apoptotic Mcl-1 protein and is associated with acute monoblastic leukemia.
21957977 We demonstrate that individual CD44 isoforms can be associated to different breast cancer subtypes and clinical markers
21953074 results indicate that the down-regulation of CD44 enhanced radiosensitivity in PC-3, PC-3M-luc, and LNCaP CaP cells, the sensitizing enhancement ratio for these cell lines was 2.3, 1.3, and 1.5, respectively
21935404 Evidence was provided that chronic drug exposure generated drug-tolerant cells via epigenetic mechanisms involving molecules such as CD44 and KDM5A.
21935375 CD44+/CD24(-or low) phenotypic radiation resistance of breast cancer cells is mediated through the enhanced activation of ATM signaling
21933023 growth defects in mesenchymal stromal cells in myelodysplastic syndromes were significantly correlated with decreases in CD44 adhesion molecules and CD49e.
21912471 LYVE-1, VEGFR-3 and CD44 all play an important role in lymphangiogenesis, invasion and metastasis
21898409 Although CD133(+) and CD133(+)/CD44(+) were detectable in human primary gastric cancers, they neither expressed stem-like properties nor exhibited tumor-initiating properties in xenograft transplantation experiments.
21895545 Data suggest that serum CD44, ICAM-1 and VCAM-1 can potentially be prognostic in patients with indolent non-Hodgkin lymphomas (NHL).
21849440 LMP1 induces the CD44(high) CD24(low) cancer stem cells/cancer progenitor cells-like phenotype as well as self-renewal abilities in LMP1-expressing epithelial cell lines.
21835433 These findings suggest that CD44(+)/CD24(-/low) breast cancer stem-like cells play an important role in the clinical behavior of triple-negative breast cancer.
21833756 High CD44 expression is associated with cholangiocarcinoma.
21830016 this is the first study to show an association between circulating sCD44 levels and survival in HER2-positive breast cancer patients.
21829201 CD44 and Musashi-1 are frequently expressed in both premalignant gastric lesions and invasive gastric cancer, whereas CD133 expression is restricted mainly to neoplastic tissues.
21827751 we review the structural biology of CD44 and of HCELL, and present current data on the function of these molecules in mediating organ-specific homing/metastasis of CTCs.
21824412 Hypoxia, as indicated by HFI-1alpha expression, might be related to the worse prognosis found in CD44+CD24-/low positive breast tumors.
21819617 Data indicate that high CD44s expression was a negative prognostic marker with significance in patients with resected NSCLC, particularly those with AC histology, and was independent of tumor stage.
21813394 Expression patterns of the pancreatic cancer stem cell surface markers CD44, CD24 and ESA were diverse in different pancreatic adenocarcinoma cell lines and changed with their local microenvironment.
21804359 single nucleotide polymorphism in the CD44 exon 2 is associated with breast cancer.
21802218 the expression of CD24, CD44, and VEGF correlated significantly positively with increasing tumor grade in human breast tumor tissues
21768350 Data show that Pic, a class 2 SPATE protein produced by Shigella flexneri 2a targets a broad range of human leukocyte glycoproteins including CD43, CD44, CD45, CD93, CD162 and the surface-attached chemokine fractalkine.
21768115 Glycosaminoglycans and glucose prevent apoptosis in 4-methylumbelliferone-treated human aortic smooth muscle cells in a process mediated by Toll-like receptor 4, CD44, and PI3K but not by ERK1/2
21764578 CD133 and CD44 proteins were highly co-expressed in colorectal cancer with early liver metastases, and may be a potential biomarker for the early liver metastases.
21749678 Data show that the alternative spliced protein isoform of CD44 (CD44st) was expressed in multidrug resistant MCF-7/Adr, Lovo/Adr, K562/Adr and HL-60/Adr cells.
21743962 HAS2-HYAL2/CD44 system may support spontaneous chemokinesis of human cancer cells through self-degradation of HMW-HA to produce LMW-HA by an autocrine mechanism.
21731740 This study has discovered a novel tumor initiating cells (TIC) surface marker, CD44, which can be utilized to enrich efficiently the TICs in Esophageal Squamous Cell Carcinoma (ESCC).
21718681 Survivin is a novel target of CD44-promoted breast tumor invasion
21708929 fibroblasts isolated from idiopathic pulmonary fibrosis exhibited an invasive phenotype that was dependent on hyaluronan synthase 2 and CD44
21701559 We propose that nuclear CD44/acetylated-STAT3 performs an unexpected tumour-progressing function by enhancing cell outgrowth into structures where cells with properties of cancer stem cells can be generated from differentiated somatic cells.
21694464 Studies indicate that 48 biomarkers have been identified for ccRCC patients, only CD44, CA9, p53, Ki67 and PCNA have shown prognostic value, and IMP-3 and VEGF-R2 are predictors of survival of pRCC patients.
21685938 novel Nanog/Stat-3 signaling pathway-specific mechanism involved in miR-21 production is significant for the formation of future intervention strategies in the treatment of HA/CD44-activated HNSCC
21680714 c-Met recruits ICAM-1 as a coreceptor to compensate for the loss of CD44 in Cd44 null mice.
21678082 CagA H. pylori infection is responsible for the tyrosine phosphorylation of beta-catenin and its nuclear translocation, which upregulates beta-catenin target gene CD44 in gastric carcinoma
21668410 Basic sequences in the cytoplasmic domains of PSGL-1, CD43, and CD44 are required for efficient association with HIV-1 Gag in HeLa cells
21649540 components of the extracellular matrix may provide survival signals to CLL cells through engagement of CD44.
21645921 Elevated levels of CD44 is associated with T cell leukemia.
21633165 Data show that the IL-6/JAK2/Stat3 pathway was preferentially active in CD44+CD24- breast cancer cells compared with other tumor cell types, and inhibition of JAK2 decreased their number and blocked growth of xenografts.
21632186 Reduced expression of CD44 could be an indicator of high invasiveness of tumor by increasing cervical lymph node metastasis.
21630198 Although MMP-2 positivity was observed in 2 malignant cases, CD44 positivity was not associated with malignancy criteria in solitary fibrous tumors
21618132 Platelet-derived P-selectin plays a prominant role in hematogenous metastasis from colon carcinoma via CD44v binding on tumor cells.
21618131 Platelet-derived P-selectin plays a prominant role in hematogenous metastasis from colon carcinoma via CD44v binding on tumor cells.
21617876 The concentration of CD44 in the peripheral blood of HNSCC patients was significantly higher compared to a healthy control group.
21570715 Hyaluronan homeostasis is deranged in asthma, with increased production by fibroblasts and decreased CD44 expression on alveolar macrophages.
21546273 Valvular interstitial cell up-regulate CD44, a receptor that binds versican.
21493336 A unique epigenetic profile consisting of 17 hypomethylated and 9 hypermethylated genes was seen in HNSCC CSCs.
21489997 Met receptors induce Sam68-dependent cell migration by activation of alternate extracellular signal-regulated kinase family members
21482826 HIV-1 p17 matrix protein interacts with heparan sulfate side chain of CD44v3, syndecan-2, and syndecan-4 proteoglycans expressed on human activated CD4+ T cells affecting tumor necrosis factor alpha and interleukin 2 production.
21482826 Basic sequences in the cytoplasmic domains of PSGL-1, CD43, and CD44 are required for efficient association with HIV-1 Gag in HeLa cells
21473743 The invasive behavior of UC-associated carcinoma is more associated with CD44 cleavage than with basement membrane disruption or sialyl-Lewis-antigen alteration.
21471434 Data conclude that fusion of the SLC1A2 gene coding region to CD44 regulatory elements likely causes SLC1A2 transcriptional dysregulation, because tumors expressing high SLC1A2 levels also tended to be CD44-SLC1A2-positive.
21471214 Differential use of chondroitin sulfate to regulate hyaluronan binding by receptor CD44 in Inflammatory and Interleukin 4-activated Macrophages.
21454519 HA facilitates TGF-beta1-dependent fibroblast proliferation through promoting interaction between CD44 and EGFR, which then promotes specific MAPK/ERK activation, inducing cellular proliferation.
21424816 CD44 negative neuroblastoma cells possess all the phenotypic and molecular features required for a cancer-initiating cell.
21411116 The possible influence of Human T-cell leukemia virus type 1 Tax protein on CD44 via an NF-kappaB pathway is reproted.
21397861 Data show that ablation of CD44 induced loss of xCT from the cell surface and suppressed tumor growth in a mouse model of gastric cancer.
21393860 regulation of CD44 alternative splicing causally contributes to EMT and breast cancer progression
21376257 Data suggest that CD44+ cells have the biological characteristics of tumor stem cell and may be assumed as one of the markers of NPC tumor stem cells.
21374592 Osteopontin stimulates autophagy directly through integrin/CD44 and p38 MAPK-mediated pathways in vascular smooth muscle cells
21356346 The recent scientific literature regarding the role of hyaluronan-mediated CD44 signaling in head and neck squamous cell carcinoma, is reviewed.
21331451 CD44 mRNA of magnetically separated CD45EpCAM+ cell fraction of peritoneal washes is a useful genetic marker for predicting high-risk individuals among gastric cancer patients with stage II and III.
21299347 Results indicate that the CD44(+)/CD24(-) cells are transit progenitors and have no association with the molecular subtypes and clinicopathological parameters in invasive ductal carcinomas.
21294926 Lewis y antigen strengthens CD44-mediated adhesion and spreading of ovarian cancer cells.
21279958 CD44s and CD44v6 are expressed in certain types of lung cancer; in adenocarcinoma CD44s and CD44v6 expression is significantly correlated with lymph node metastases and tumor size
21278261 Dysregulation of the ezrin/radixin/moesin-RAGE complex might be an important step in rearrangement of the actin cytoskeleton during proinflammatory cytokine-induced epithelial-mesenchymal transition of human alveolar epithelial cells.
21258793 Expression patterns of CD44 isoforms display strong variations dependent on cell type, state of activation, and differentiation stage; this is particularly evident in hematological neoplasias. [REVIEW]
21257905 hMSCs coordinately integrate CD44 ligation and integrin activation, circumventing chemokine-mediated signaling, yielding a step 2-bypass pathway of the canonical multistep paradigm of cell migration.
21257828 Both endothelial cell E- and P-selectins are implicated in ischemia/reperfusion-induced stem cell recruitment to the infarct site where transgenic CD44 serves as the ligand that engages P- and E-selectin on the cerebral microvasculature.
21254647 The high expression of PD4, CD44 and PCNA proteins may be closely related to the pathogenesis, development and prognosis of laryngeal carcinoma.
21215700 Abnormally elevated levels of oral lichen planus may contribute to the abnormal infiltration and accumulation of activated T cells by up-regulating CD44.
21194677 genetic association with systemic lupus erythematosus to a haplotype between PDHX and CD44 was established.
21179550 retinaldehyde-induced skin hyperplasia is a Cd44-dependent phenomenon
21151997 Membrane-Associated RING-CH proteins MARCH VIII and MARCH IV associate with Bap31 and target CD81 and CD44 to lysosomes
21136024 both versican and CD44 play an important role regulating the behavior of malignant melanoma cells
21124918 Results demonstrated that stem cell-like properties are enriched in CD44-expressing subpopulations of some lung cancer cell lines.
21105049 Germline polymorphisms in CD44 is associated with gastric adenocarcinoma.
21098716 Data demonstrated that ALDH and CD44 select a subpopulation of cells that are highly tumorigenic.
21087933 membrane lipid organization regulates CD44 shedding
21078678 V3 isoform of versican interferes with CD44 and the CD44-EGFR/ErbB2 interaction, altering the signaling pathways, such as ERK1/2 and p38 MAPK, that regulate cell proliferation and migration
21055388 An inverse correlation between the expression of miR-199a-3p and CD44 protein was noted in primary hepatocellular carcinoma specimens.
20974992 An epithelial-expressed CD44 variant 6 plays a role in neutrophil (PMN) clearance during inflammatory episodes through regulation of the terminal detachment of PMNs from the apical epithelial surface into the lumen of the intestine.
20971508 Cyclopamine and a monoclonal antibody to ligate CD44 more than additively induced the differentiation of HL-60 cells.
20969572 CD44 is identified as an early cell surface marker of the Muller glia lineage in transgenic mice.
20962267 CD44 is a partner for podoplanin. Expression of the CD44 standard isoform is coordinately up-regulated with that of podoplanin during progression to aggressive SCCs in a mouse skin model of carcinogenesis, and during epithelial-mesenchymal transition.
20956971 study reports the new machinery by which RHAMM/ERK interaction induces the proliferative activity of cementifying fibroma cells via a specific signaling pathway through the CD44-EGFR axis
20920234 CD44 is epigenetically regulated in lymphoma and undergoes de novo methylation in distinct lymphoma subtypes like Burkitt lymphoma
20856229 lack of expression of CD44 isoforms containing exon v6 in the surface and foveolar epithelia of normal stomach and, its de novo expression in premalignant, as well as in sporadic and hereditary malignant lesions of the stomach
20851866 Observational study of gene-disease association. (HuGE Navigator)
20843027 thio substitution at specific positions of the DNA phosphate backbone results in specific and high-affinity binding of thioaptamers to CD44
20837694 CD44 was the only biological factor tested which significantly correlated with response to radiotherapy in early stage larynx cancer patients, both at the mRNA and protein levels.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20809185 Elevated levels of soluble CD44s and IFN-gamma were associated with advanced B-cell chronic lymphocytic leukemia as reflected by increased values as disease stage progresses.
20806065 Observational study of gene-disease association. (HuGE Navigator)
20799279 These results provide a direct evidence for the involvement of CD44 in the hyaluronan-dependent regulation of osteoclast activity.
20698358 EGFR promoter hypermethylation does not seem to represent a rare event in colorectal cancer and may be present differently in different tumor sites.
20696077 CD44 upregulation is associated with invasive cell populations of breast cancer.
20670691 These results demonstrate that, in the cell lines that we used, CD44 receptors play no role in the activation of c-Met, neither during Listeria monocytogenes entry via the function of inlB, nor upon HGF activation.
20663884 multivalent nature of CD44-HA interactions and suggest a molecular basis for the distinct biological properties of different size fractions of hyaluronan.
20663864 Transportin regulates nuclear import of CD44.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20606732 The pattern of CD44 expression in Neurofibromatosis type 1 is interpreted as a reflection of the interaction of CD44+ tumor cells with extracellular matrix, hence facilitating infiltrative behavior
20606680 Prognostic impact of this and other cancer stem cell markers expression in colorectal cancer.
20605145 Expression of CD44 in endometrium and fallopian tubes from infertile women.
20588206 Kidney tranplantation CD44 expression correlates with long term kidney function and intertitial fibrosis and tubular trophy.
20562647 Neither CD44H nor ezrin immunoexpression could predict the prognosis for patients with osteosarcoma in our small sample.
20552237 high molecular weight of HA suppressed the FN-f-activated p38 via ICAM-1 and the CD44 in RA chondrocytes
20530438 Results suggest that CD44 polymorphism is associated with breast cancer development, and CD44 polymorphism analysis may be effectively used in the risk assessment, prediction, prevention, diagnosis and genetic epidemiological analysis of breast cancer.
20530438 Observational study of gene-disease association. (HuGE Navigator)
20526812 CD133+ CD44+ subgroups may be human small intestinal stem cells
20525896 Activated CD44-expressing fraction of Vgamma4 gammadelta T cells plays a critical role in melanoma antitumor responses.
20491779 Combined anticancer agents formestane and herceptin are active on a subpopulation of CD44high/CD24low breast cancer cells.
20454640 MCT1, MCT2, and MCT4 protein expression in breast, colon, lung, and ovary neoplasms, as well as CD147 and CD44, were analysed.
20416163 Silencing CD44 can inhibit K562/A02 cell proliferation, induce apoptosis and effectively reverse the multidrug resistance of K562/A02 cells.
20405247 Lack of CD44 expression was associated with lymph node involvement, regardless of CD24 status, whereas the lack of both CD44 and CD24 was connected with high histologic grade and unfavorable prognosis which, notably, was the worse among all phenotypes
20403620 Absent CD44v6 expression is an independent adverse predictor of urothelial bladder cancer recurrence and overall survival
20382854 CD44 is a senescence-induced cell adhesion gene responsible for the enhanced monocyte recruitment to senescent endothelial cells.
20374021 The decrease of CD44v6 expression promoted recurrence and carcinogenesis of parotid pleomorphic adenoma, and the expression was decreased further in the process; expression differences of CD44v6 appeared before the recurrence
20361869 We characterized PCBP1 as a negative regulator of CD44 variants splicing in HepG2 cells
20357818 HGF-induced motility in primary human melanocytes depends on c-Met-CD44v6 interaction
20306693 Data suggest that sCD44 may be a good marker for prognosis and a marker for monitoring response to therapy.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20228222 ALDH1, CD44, and cytokeratin have roles in breast cancer progression
20212041 TM domains of L-selectin and CD44 play a crucial role in cell adhesion under flow by targeting receptors to microvilli or the cell body, respectively.
20211062 CD44v17 regulates the expression of MMP-2 and MMP-9, which increases the invasion ability of MCF-7 cells through the Ras/MAPK signaling pathway.
20200161 Study describes a model that stroma-derived HGF and hyaluronan influence androgen receptor and CD44 functions in the secretory epithelia during prostate carcinogenesis.
20199686 EGFR genome modulation in the CD44+/CD24-/low subpopulation of the breast cancer cell line MDA-MB-468 leads to different coexisting subclones
20193563 COX2 was correlated with clinical stage and tumor volume in early-stage squamous carcinoma of cervix, while there was no correlation with P53, CD44V6 and clinical factors.
20178130 CD44 fragmentation, consistent with a signature pattern reported for sequential metalloproteinase/gamma-secretase cleavage of CD44, is a common metabolic feature of chondrocytes undergoing dedifferentiation in vitro and osteoarthritic chondrocytes
20157733 The overexpression of CD44v6 is an independent prognostic marker for predicting survival in breast cancer.
20142144 observed by AFM that hyaluronan formed honeycomb-like network structures, to which the recombinant protein of CD44 extracellular domain intensively adhered
20139419 Basic sequences in the cytoplasmic domains of PSGL-1, CD43, and CD44 are required for efficient association with HIV-1 Gag in HeLa cells
20127679 The interaction between CD44 & LSECtin is dependent on protein-glycan recognition. CD44 is the 1st identified endogenous ligand of LSECtin, & similarly, LSECtin is a novel ligand of CD44.
20121756 Cd44 expression is increased in asthmatic bronchial smooth muscle (BSM) cells and is involved ,as is collagen, and CD51, in mast cell-BSM cell adhesion particularly under inflammatory conditions.
20098615 Observational study of gene-disease association. (HuGE Navigator)
20093489 Hyaluronan can serve as a signal integrator by facilitating TGF-beta1-mediated CD44-EGF-R-ERK interactions and ultimately fibroblast phenotype.
20093404 we identified CD44, located on chromosome 11p13, as a novel translocation partner of IGH in 9 of 114 cases of gastric, nongastric extranodal, follicular, and nodal diffuse large B-cell lymphoma
20083228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20042890 CD44 antigen expression was higher in melanomas with known metastases than in those without metastases
20019840 ata demonstrate that the overexpression of Twist in breast cells can promote the generation of a cancer stem cell phenotype characterized by the high expression of CD44, little or no expression of CD24, and increased aldehyde dehydrogenase 1 activity.
19996285 Our findings define genetic markers in 14-3-3tau and CD44 that might improve the treatment and prognosis of soft-tissue sarcomas.
19965872 Data show that TNF-alpha induces the formation of fibrotic foci by cultured retinal pigment epithelial cells through activation of transforming growth factor-TGF-beta signaling in a manner dependent on hyaluronan-CD44-moesin interaction.
19955840 CD44s expression in TURP chips might be a valuable adjunct to better predict outcome in incidental prostate cancer prior to radical prostatectomy.
19952968 Data indicate that CD44v6 expression determines the morphology and aggressiveness of IPMNs and is involved in development and invasion of IPMNs.
19937401 The loss of CD44s expression in cancer cells in the deepest invaded area is a good marker for predicting potential metastasis to lymph nodes and liver in T3 colorectal cancer
19914206 up-regulation of CD44 and ICAM-1 expression on the surface of T. gondii-infected human monocytic THP-1 cells and fresh isolated human monocyte was demonstrated.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19912362 CD44v6 was associated with pT stage, lymph node metastasis, an infiltrating tumour margin and adverse prognosis of colorectal cancer, but was not an independent prognostic factor
19906290 Data demonstrate that the invasive, mesenchymal CD44posCD24neg phenotype is under dynamic control in breast cancer cell lines both in vitro and in vivo.
19857547 coexpression of any of the CD44v with the receptor for hyaluronic acid-mediated motility (RHAMM, CD168) identifies a subgroup of DLBCL patients with a very poor prognosis, independent of the International Prognostic Index
19826051 Overexpression of CD44 is associated with hepatocellular carcinoma.
19816074 This is the first report of a significant correlation between COX-2, CD44v6, and nm23H1 in ESCC.
19799609 a decrease in CDH1, CDH13, and TIMP3 expression levels with an increase in CD44 can be used as an indicator for invasion in both ER-positive and -negative breast tumors.
19794964 Data show HUVEC-UKF-NB-4 interaction led to distinct reductions of CD44v4, CD44v5, and CD44v7 levels.
19794958 Data show that tumor cells containing the stem cell-like CD44(+)/CD24(-) signature had a lower expression of the M-phase cell cycle genes than the CD44(-)/CD24(+) cells, and in the CD44(+)/CD24(-) cocultures, these genes were induced.
19794081 CD44 may play a role in red cell turnover, and its linkage to 4.1R may be relevant to this process.
19787231 High CD44 expression is associated with tumor progression of follicular lymphoma.
19787202 These data report for the first time frequent expression of neoplasia-associated CD44v3,v8-10 variants in colorectal adenomas and carcinomas.
19773544 Data suggest that the coreceptor function of CD44v6 for c-Met and VEGFR-2 is a promising target to block angiogenesis in pathologic conditions.
19764564 Both high pressure CO2 and 5% dextrose solution can increase the expression of CD44 and ICAM-1 in endometrial cancer cells.
19724852 positive expression of both CD44v6 and MMP-7, and negative expression of nuclear Cdx2 may serve as powerful predictors of lymph node metastasis in gastric cancer
19703720 Adhesion of haematopoietic stem cells to liver compartments is integrin and CD44 dependent and modulated by CXCR3 and CXCR4.
19698232 PKC activation can up-regulate CD44 expression by phosphorylation in human erythrocytes.
19638429 endogenous IL-18 might facilitate stomach cancer cell immune escape by suppressing CD70 and increasing metastatic ability by upregulating CD44 and VEGF
19635906 Cross-linking of CD44 by high-molecular-weight hyaluronan and potentially other intact extracellular matrix components promotes regulatory T cell persistence and function.
19633292 Results indicate that HA binding to CD44 promotes PKCepsilon activation, increases the phosphorylation of the stem cell marker, Nanog, leads to microRNA-21 (miR-21) production and PDCD4 reduction.
19626493 Report prognostic significance of the cancer stem cell markers CD133, CD44, and CD166 in colorectal cancer.
19621595 The expression of CD44v6 protein in supraglottic cancer is significantly increased. Expression has a close relationship with pathologic differentiation and clinical stage and cervical lymph node metastasis.
19598259 High CD44 expression is associated with gemcitabine resistance in pancreatic cancer.
19582779 surface expression of CD44 and activation of MMP9 on the cell surface are interdependent.
19580891 The linked synonymous variant found in exon 9 of the CD44 gene might be increasing susceptibility to osteoporosis in this family by affecting the splicing mechanism.
19563418 Serum sCD44v6 may be a valuable marker in monitoring treatment response in patients with oral and maxillofacial squamous cell carcinoma.
19506034 Data show that in the nucleus, the acetylated STAT3 dimer is associated with CD44 and binds to the cyclin D1 promoter, leading to increased cyclin D1 expression and cell proliferation.
19488035 Our results identify differences between CD44v6-positive and CD44v6-negative breast carcinoma cells in vivo.
19434087 description of proteolytic cleavage of CD44
19432801 CD44v6 is required for InlB-induced c-Met activation in Listeria invasion.
19416960 Our results indicate a role for CD44 in modulation of susceptibility to acetaminophen hepatotoxicity.
19416960 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19415765 Gastric cancer-initiating cells were identified from a panel of human gastric cancer cell lines using cell surface marker CD44.
19396460 Loss of CD44 and gain of DKK1 expression characterizes progression from Barrett esophagus to dysplasia and adenocarcinoma.
19385591 the prevalence of CD44+ tumour cells as a subpopulation of breast cancer stem cells was of no clinicopathological significance, but was correlated with higher Bcl-2 expression
19360323 Reduction of distinct high-molecular CD44v3, v5 and v8 variants following butyrate-induced differentiation in colon cancer cells.
19351367 CD44 overexpression may be an independent unfavorable prognostic factor for overall survival in advanced cancer
19350388 Given that expression of CD44 is not an absolute requirement for the survival of cells harbouring CD44 gene amplification, CD44 is unlikely to be a driver of the 11p13 amplicon.
19331807 The data suggest that Ezrin, but not CD44 and Six1, could be a prognostic factor and a predictor of potential lung metastasis in osteosarcoma.
19277703 COX-2 expression has a more significant impact than CD44 expression on the survival of colorectal cancer patients.
19275586 Basic sequences in the cytoplasmic domains of PSGL-1, CD43, and CD44 are required for efficient association with HIV-1 Gag in HeLa cells
19254252 Variants within CD44 genes linked to an inherited haplotype in a family with coeliac disease
19243022 TGF-beta treatment promotes MDA-MB-435s cell migration, involving MT1-MMP-mediated CD44 cleavage.
19200980 Increased eutopic endometrial-peritoneal mesothelial cells adherence and CD44 splice variant expression may contribute to the histogenesis of endometriotic lesions.
19176383 Interactions among hyaluronan, CD44, and emmprin contribute to regulation of monocarboxylate transporter in the cell membrane of breast cancer cells.
19167378 CD44 expression on breast cancer cells is a major contributing factor to cell adhesion, migration and invasion.
19148550 that CD44 expression does not correlate with matrix assembly in chondrocytes and that CD44 has a regulatory function in chondrocytes, not necessarily on differentiation, but probably on proliferation.
19141242 The affinity of Merlin to CD44 was increased after phosphorylation at S518 in vestibular schwannoma.
19100415 CD44 may be a marker of inflammation and endothelial dysfunction in kidney allograft recipients.
19097357 high CD44 expression in nephroblastoma group of tumors may confirm their high malignant potential.
19088176 Dermatan sulfate proteoglycan biglycan is a potential selectin L/CD44 ligand involved in tethering/rolling of peripheral blood CD16(-) NK cells on endometrial microvascular endothelial cells.
19077409 CD44s may play a role in the formation of renal vein or vena cava extention
19073595 the heparan sulfate proteoglycan form of epithelial CD44v3 plays a critical role in facilitating PMN recruitment during inflammatory episodes via directly binding to CD11b/CD18.
19023892 These results support a role for MT1-MMP in cell retraction during CD44-mediated cell invasion.
19017937 Analogous to EAE, in subjects with MS, we found increased expression of Opn in DCs and increased expression of the Opn receptors CD44, beta(3), and alpha(v) on T cells.
19017033 Epithelial CD44 expression was strong in all groups, while CD44 was significantly enhanced in connective tissue cells from both diabetic+periodontitis groups.
19010227 Expression of both OPN and CD44s in hepatocellular carcinoma is associated with advanced tumor stage and contributes to prognosis information.
19009655 CD44 is highly expressed in gastric adenocarcinoma and is correlated with a poor prognosis in patients with the intestinal type of gastric adenocarcinoma.
19004834 CD44-binding site is localized within the N-terminal portion of the fibrin beta chains, including amino acid residues (beta15-66)
18997126 OPN combined with CD44 is a promising independent predictor of tumor recurrence and survival in hepatocellular carcinoma patients.
18981124 hyaluronan induces cell death in activated T cells via CD44
18980968 These results indicate that CD44 is a robust marker and is of functional importance for colorectal CSC for cancer initiation.
18971959 ADAM10 is the predominant protease involved in the constitutive shedding of endogenous CD44 from melanoma cells
18952835 Data show that hepatic CD44 expressions were related to insulin resistance and steatosis, suggesting their local implication in the progression of liver injury.
18852874 CD44s and CD44v6 levels in head and neck epithelia, and in lymphocytes, and in head and neck squamous cell carcinoma
18835619 the utility of immunohistochemical staining for CD44 in distinguishing prostatic small cell neuroendocrine carcinoma from its mimickers
18804988 Monocyte CD44 and CD44v3 expression are altered in arterial disease but are returned towards levels seen in control subjects by dietary fish oil supplementation.
18804101 The diagnostic efficacy of urinary CD44 and cytokeratin 20 (CK20) mRNA in comparison with voided urine cytology (VUC) for the detection of bladder cancer, was evaluated.
18787423 Immuno-localization of CD44 and osteopontin in developing human kidney.
18757307 Results show that oxidative stress induces MUC5B up-regulation, which requires CD44 as well as EGFR and MAPK activation.
18753140 analysis of how the the CD44 tail is released from the cytoskeleton for nuclear translocation by regulated intramembrane proteolysis
18662989 senescence of primary NHP cells expressing progenitor cell markers CD44, alpha2beta1, p63, hTERT, and CK5/CK18, involves loss of telomerase expression, up-regulation of p16, and activation of p53.
18654930 Among the NHE7-binding proteins identified, CD44, a cell surface glycoprotein receptor for hyaluronate and other ligands, showed regulated interaction with NHE7.
18651220 Some cases of chronic pancreatitis and autoimmune pancreatitis expressed CD44 in centroacinar cells and ductal cells.
18644869 This study demonstrates an important role of the dynamic raft reorganization induced by CD44 clustering in eliciting the matrix-derived survival signal through the CD44-SRC-integrin beta1 axis .
18632604 CD44 but not CD24 may be involved in the breast cancer pathway and is a target for oncolytic virotherapy
18614011 In the absence of p53 function, the resulting derepressed CD44 expression is essential for the growth and tumor-initiating ability of highly tumorigenic mammary epithelial cells.
18612220 CD44-positive neuroblastomas produced multicellular metastases predominantly located in the intra- and periarterial space of the lung.
18608209 Bladder cancer stem (initiating) cells might be among EMA(-) CD44v6(+) subset.
18577517 Hyaluronic acid promotes CD44-EGFR interaction, which in turn activates PKC signaling, involving Akt, Rac1, Phox, and the production of ROS, FAK, and MMP-2, to enhance melanoma cell motility.
18559090 analysis of CD44 and CD24 expression in breast tumors
18516325 E-cadherine and CD44 immunoexpression in oral squamous cell carcinoma as prognosis factors.
18513329 High molecular weight hyaluronan-CD44 signaling from the apical surface-membrane regulates orientation of mitotic spindle axis to align the parallel to the basal extracellular matrix.
18502153 Report expression of tenascin-c and CD44 receptors in cardiac myxomas.
18502033 TIMP1 functions as a differentiating and survival factor of GC B cells by modulating CD44 and SHP1 in the late centrocyte/post-GC stage, regardless of EBV infection.
18495204 In breast tissue, CD44(+)/CD24(-/low) tumor cells seem to be associated with lack of lymph node metastasis and a tendency toward an increase of the relapse-free survival of the patients.
18476632 CD44 and nm23-H1 proteins play an important coordinated regulation role in the carcinogenesis, development and metastasis of laryngeal carcinoma.
18476625 the pathogenesis, development and prognosis of laryngeal carcinoma maybe closely related to the high expression of PD4 and CD44v6, CD44v9 proteins.
18450824 CD44 has a pivotal role in the trans-endothelial migration of NPCs across brain endothelial cells
18450428 In vitro reconstructed normal human epidermis expresses differentiation-related proteoglycans (CD44, syndecan-1, desmosealin, and 7C1).
18441325 HA binding to tumor cells promotes Nanog protein association with CD44 followed by Nanog activation and the expression of pluripotent stem cell regulators, and forms a complex with Stat-3 in the nucleus leading to Stat-3 and MDR1 activation
18438684 Clinical significance of the positive correlation of elevated CD44 blood levels and lymph node metastases of breast cancers.
18415803 analysis of variant CD44 expression by human fibroblasts
18414895 Immunohistochemical assessment of both Survivin and CD44v6 status in negative surgical margin may be a valuable approach for predicting recurrence and survival after curative surgery for laryngeal cancer.
18396641 No apparent correlation is observed between CD44v6 expression in gastric carcinoma and that of sCD44v6 in the blood.
18387829 HSP72 was associated with CD44v6 precursor fragments in human colonic carcinoma cells. The interaction between HSP72 and CD44v6 in human colonic carcinoma cells may contribute to study the pathogenesis and immunotherapy of colonic carcinoma.
18375392 CEA and CD44v cooperate to mediate colon carcinoma cell adhesion to E- and L-selectin at elevated shear stresses.
18372518 diminished or lack of CD44 may be an accompaniment of enhanced metastatic potential
18350162 demonstrated, for the first time, that breast cancer cell CD44v4 is a major E-selectin ligand in facilitating tumor cell migration across endothelial monolayers
18326820 B-CLL cells attached to and bound proMMP-9 and active MMP-9, and this was inhibited by blocking the expression or function of alpha4beta1 or CD44.
18279620 E-cad, CD44v6 and PCNA play important roles in invasion and metastasis of non-small cell lung cancer (NSCLC).
18276068 Here we show that epidermal growth factor (EGF) and heregulin induce CD44 shedding in JIMT-1, an ErbB2-overexpressing cell line resistant to trastuzumab, accompanied by internalization and intramembrane proteolysis of CD44 and enhanced cellular motility.
18265895 Crucial participants in tumour invasion and metastases are matrix metalloproteinases, tissue inhibitor of metalloproteinase inhibitors and cellular adhesion molecules. They play roles in tumour invasion and metastasis in non-small-cell lung carcinomas.
18246799 The expression of CD44-v6 in esophageal squamous cell carcinoma had a close relation to tumor differentiation and lymph node metastasis.
18234849 The apparent metastatic potential associated with CD44 overexpression on colon carcinoma cells and the critical roles of P-selectin and fibrin(ogen) in metastatic spread are reported.
18227732 study demonstrates decreased expression of CD44s accompanied by increased expression of CD44v6 and increased stromal hyaluronan in breast cancer
18214619 We believe that CD44s-mediated adhesion of malignant cells to other cells or to the extracellular matrix is responsible for the invasive features of biliary tract neoplasms, its aggressive progression, and its resistance to treatment.
18199543 Hyaluronic acid synthase-1 expression regulates bladder cancer growth, invasion, and angiogenesis through CD44.
18193058 These findings establish that the HCELL glycoform of CD44 confers tropism to bone and unveil a readily translatable roadmap for programming cellular trafficking by chemical engineering of glycans on a distinct membrane glycoprotein.
18162778 staining for TCL1, CD38, and CD44 are useful ancillary tests to identify B-cell tumors
18160820 Various adhesion proteins, including CD44, are involved in the contact of human hematopoietic progenitor cells and human mesenchymal stromal cells.
18155656 These are the first data to suggest a role for osteocytes and OPN in the recruitment of mesenchymal stem cells to aid in fracture repair.
18094716 The CD44 gene is silenced in NB4 acute promyelocytic leukemia cells by DNA methylation of a CpG island & underacetylation of histone H3 at the promoter. Brahma protein & phosphorylated RNA Pol II interact with the promoter region of CD44.
18092951 Significance of CD44 expression in transitional cell carcinoma of the bladder and explanaion for results on the relationship between CD44 expression and the biological behaviour of urothelial cells.
18077444 cell migration involving CD44-mediated signaling through ERK1/2 is modulated by hyaluronan
18048043 higher levels found in the placentas of pre-eclamptic compared with normotensive women
18005092 Expression defines phenotypic stages in B cell precursor develoment.
17987038 Finding identify OPN and CD44v6 as predictive markers of recurrence or aggressiveness in laryngeal intraepithelial neoplasia, and overall, point out an important signalling complex in the evolution of laryngeal dysplasia.
17975002 CD44v6-positive sorted lymphangioleiomyomatosis cells showed loss of heterozygosity at the TSC2 locus; binding of CD44v6 antibody resulted in loss of cell viability.
17945213 These findings indicate that the secretion of soluble CD44 contributes to colon cancer growth in vitro, possibly as a decoy receptor.
17945212 Results indicate that siRNA targeting a discrete sequence of human CD44 may provide a potential therapeutic option for colon cancer.
17940137 Multisite v3 splicing enhancer is functional irrespective of flanking intron length and spatial organization within v3.
17919613 The concentration of the soluble form of CD44, a competitive inhibitor for CD44 and hyaluronic acid binding, is higher in the peritoneal fluid of patients with endometriosis than in the peritoneal fluid of patients without endometriosis.
17914409 gene expression profiling study of contribution of GM-CSF and IL-8 to the CD44-induced differentiation of acute monoblastic leukemia
17911438 CD44 targeting by antibody, passively injected into DBA/1 mice with collagen-induced arthritis (CIA) and NOD mice with type I diabetes or actively generated by CD44 cDNA vaccination of SJL/j mice with autoimmune encephalomyelitis[review]
17849363 Pesence of many CD44 isoforms, which cannot be distinguished with commercially used antibodies, but may play a different role in pathogenesis and spread of neuroblastoma.
17846873 our findings provided additional evidence that the pathological stress, such as chronic inflammation, altered the expression of CD44 isoforms in oral epithelia and saliva of oral lichen planus patients
17726647 Signals from the extracellular association CD44-ezrin-actin are an important modulator of Fas-mediated apoptosis.
17708612 Fuzheng Yiliu granules enhance the immune adhesion function of RBCs and reduce the number of CD44(+)-cells in esophageal carcinoma patients.
17702746 CD44 is an important regulator of HGF/c-Met-mediated in vitro and in vivo barrier enhancement, a process with essential involvement of Tiam1, Rac1, dynamin 2, and cortactin.
17679465 CD44 may have an important role in the development of malignancy and in the determination of biological features of keratoacanthoma and squamous cell carcinoma of the skin.
17657222 AML1-ETO and its splice variant AML1-ETO9a regulate the expression of the CD44 gene, linking the 8;21 translocation to the regulation of a cell adhesion molecule that is involved in the growth and maintenance of the acute myeloid leukemia blast/stem cells
17638891 CD44+alpha2beta1+ cell population is enriched in tumor-initiatin prostate cancer cells
17627000 SolCD44 is elevated in the majority of head and neck cancer
17611662 Data indicate a positive association of CD44 expression with the malignant activities of CNE-2L2 cells and suggest a possible therapeutic effect of direct introduction of siRNA to CD44 into tumors in some solid tumors with high expression of CD44 gene.
17611661 Low expression of CD44s is related to tumour cell invasiveness and may be of clinical relevance as a prognostic factor.
17599831 CD44-induced cell migration is dependent on its complex formation with Lyn and its consequent regulation of AKT phosphorylation in colon cancer cells.
17589956 TNM staging, preoperative CEA and CD44v6 were independent prognostic factors for rectal cancer patients with total mesorectal excision.
17581168 Two novel CD44 antigens of high incidence have been identified: IN3 (INFI) and IN4 (INJA) in the IN (Indian) blood group system. Lack of IN3 and IN4 results from homozygosity for mutations encoding H85Q and T163R in CD44, respectively.
17579117 claudin-7-associated EpCAM is recruited into (tetraspanin-enriched membrane microdomains) and forms a complex with CO-029 and CD44v6 that facilitates metastasis formation
17540049 CD44+ breast cancer cells are successful in overcoming an engraftment incompatibility that exists when injecting human cells into mouse adipose tissue
17516109 Loss of CD44 expression in gastrointestinal stromal tumors was associated with disease progression.
17482182 In endometrium, l-selectin is found in greater abundance in interstitial space than in epithelium.
17479111 novel mechanism of apoptosis induction in Crohn disease mediated by CD44v7 ligation
17464868 Cell adhesion protein CD44 (especially CD44v6 isoform) expression was up-regulated in cervical carcinoma associated with humanpapillomavirus (HPV) infection
17392272 an effect of CD44 on tumor cell motility may depend in part on its ability to partner with additional proteins, such as cell surface Rhamm.
17383158 study describes disease-specific CD44 variant expressed on synovial fluid cells of rheumatoid arthritis patients
17381240 Basic sequences in the cytoplasmic domains of PSGL-1, CD43, and CD44 are required for efficient association with HIV-1 Gag in HeLa cells
17343740 CD44 surface expression is an important event in the activation of MMP-9 and migration of prostate cancer cells.
17332338 OPN-CD44(V) interaction promotes ECM-derived survival signal mediated through integrin activation, which may play an important role in the pathogenic development and progression of gastric cancer.
17265493 Chondrocytes with low chondrogenic capacity expressed higher levels of IGF-1, MMP-2, aggrecanase 2, while chondrocytes with high chondrogenic capacity expressed higher levels of CD44, CD151, and CD49c.
17237445 increased CD44, ezrin, radixin, and moesin phosphorylation represents a key molecular abnormality that guides T cell adhesion and migration in SLE patients.
17136494 interaction between membrane-bound hyaluronan and the cell surface CD44 was involved in the up-regulation of FasL expression on T cells and subsequent activation-induced cell death
17135256 CD44 variant isoform (CD44v) is a functional P-selectin ligand on colon carcinoma, providing a novel perspective on the enhanced metastatic potential associated with tumor CD44v overexpression and the role of selectins in metastasis.
17092940 N-WASP plays a pivotal role in regulating hyaluronan-mediated CD44-ErbB2 interaction, beta-catenin signaling, and actin cytoskeleton functions that are required for tumor-specific behaviors and ovarian cancer progression
17085435 The order-to-disorder transition of the carboxyl-terminal region by hyaluronan binding may be involved in CD44-mediated cell migration.
16998484 CD44 is a key regulator of acute myeloid leukemic stem cells
16998483 BCR-ABL-expressing leukemic stem cells depend to a greater extent on CD44 for homing and engraftment than do normal hematopoietic stem cells
16969488 up-regulated CD44s expression in metastases is associated with a shorter disease-free survival of colorectal neoplasms
16868940 Overexpression of CD44v6 is associated with early-onset gastric carcinomas
16848180 The expressions of CD44 and nm23-H1 in the metastatic lymph node tumor had no difference compared with that in primary tumor of supraglottic or hypopharyngeal cancer.
16809345 Results suggest that hyaluronan suppresses PDGF beta-receptor activation by recruiting a CD44-associated tyrosine phosphatase to the receptor.
16713680 Hyaluronidase and CD44 hyaluronan receptor are expressed in squamous cell laryngeal carcinoma
16702221 CD44-hyaluronan (HA) interaction is involved inand leukocyte adhesion.
16652145 functional experiments, tet-regulated induction of CD44s potentiated the migration and invasion of MCF7F cells through HA-supplemented Matrigel
16636662 CD44 ligation triggers a novel caspase-independent cell death pathway via calpain-dependent AIF release in erythroleukemia cells.
16620830 An IL-6-CD44 feedback loop in macrophages may aggravate atherosclerosis development.
16565092 expression of HCELL confers robust and predominant tumor cell binding to E- and L-selectin
16565089 CD44 interaction with LARG and EGFR plays a pivotal role in Rho/Ras co-activation, PLC epsilon-Ca2+ signaling, and Raf/ERK up-regulation required for CaMKII-mediated cytoskeleton function and in head and neck squamous cell carcinoma progression
16554035 We conclude that cell matrix factors act cooperatively with cytokines to induce the expression of the components of the NADPH-oxidase in monocytic progenitor cells.
16533775 Increased CD44 antigen is associated with relapses in non-small cell lung cancers
16530165 There is a cryptic splice site, in intron 6 of the human CD44 gene, used during mRNA processing.
16504370 results suggest that CD44 splicing variants might play a role in the invasion of trophoblast into maternal tissue in early pregnancy
16494036 CD44v6 functions in the carcinogenesis process of laryngeal squamous cell carcinoma.
16478744 CD44 was methylated in the prostatic tumor epithelium from four of the five patients but not in the tumor stroma.
16419149 Data suggest that CD44 expression level is linked to the cell cycle in gastrointestinal tumor cells, which in turn leads to cell cycle dependent alterations of their adhesion behaviour to endothelium.
16415175 Observational study of gene-disease association. (HuGE Navigator)
16407205 These results are consistent with the concept that tumor cells generate hyaluronan oligosaccharides that bind to tumor cell CD44 through the expression of their own constitutive hyaluronidases.
16390331 EGF induces ADAM10-mediated CD44 cleavage through Rac1 and mitogen-activated protein kinase activation, and thereby promotes tumour cell migration and invasion.
16354706 SRm160, a splicing coactivator, regulates CD44 alternative splicing in a Ras-dependent manner.
16352650 variant isoforms of CD44 on LS174T colon carcinoma cells possess selectin binding activity, in contrast to the standard isoform of CD44 on hematopoietic-progenitor cells.
16325770 Taken together, engagement of CD44 (e.g., hyaluronan) and glycated albumin induced the differentiation of resting monocytes into foam macrophages through the induction of MSRs.
16311123 results suggest an established Wnt signaling pathway in most gastric cancers, a close correlation of beta-catenin/TCF4-mediated signaling with tumor dissemination, and the unlikelihood of a direct effect of activated Wnt signaling on CD44 expression
16248506 There was a significant positive correlation between the expression of CD44v6 and MMP-9 in laryngeal squamous cell carcinoma.
16234326 Directional migration of breast cancer cells towards hyaluronan is dependent on CD44
16229685 The cleavage of the ectodomains of L1 and CD44 is initiated in an endosomal compartment that is subsequently released in the form of exosomes.
16219515 human cervical CD44 mRNA expression is induced by interleukin-1beta so hyaluronic acid in the cervical tissue is increased because of the expression of CD44
16208414 CD44 ligation by MAb induces activation of both initiator caspase-8 and -9 and effector caspase-3 and -7; but only inhibition of caspase-3/7 and caspase-8 reduces CD44 ligation-induced apoptosis
16177123 CD44 is part of the putative cell surface vitamin D binding protein binding site complex and functions to mediate the chemotactic cofactor effect.
16166750 Patients who later developed renal allograft rejection had statistically significantly increased soluble CD44 levels, but not soluble ICAM-1, IL-2R or CRP in plasma prior to transplantation.
16085055 Function of tumor-derived soluble CD44, like the transmembrane form of the receptor, can be regulated.
16002044 Serine 180 is the site for chondroitin sulfate addition in CD44H and that this negatively regulates hyaluronan binding.
15990174 CD44 and CD49d are putative activity markers and CD44 a potential novel therapeutic target in multiple sclerosis.
15962382 measurement of CD44v6 expression in peripheral blood by RT-PCR is not suitable for detection of circulating tumor cells.
15943035 after the 10-year follow-up, expression of CD44v7-v8 was associated with poor prognosis for breast cancer patients
15923644 TNF-alpha-induced CD44 expression was regulated by AP-1 through the activation of the CaMK-II pathway, whereas LPS-induced CD44 transcription was regulated specifically by Egr-1 through JNK activation.
15867228 CD44 expression may be a favorable prognostic factor in patients with node-negative invasive breast carcinoma.
15816636 CD44v6 expression is associated with deep stromal invasion in cervical carcinoma
15809746 CD44 and membranous E-cadherin expression were correlated with the depth of primary tumour invasion.
15783086 We conclude that CD44v6 expression correlates with a higher proliferative activity and with a stem cell-like phenotype in both cell lines and with cellular atypia in HT1197 cells.
15736104 data obtained with human arterial smooth muscle cells in vitro support a role of CD44 in the smooth muscle cell response to the metabolic and hormonal disorders of diabetes
15728517 Engagement of CD44 mediates deactivation of human monocytes in the presence of tumor cells, an effect apparently involved in IL-1 receptor associated kinase-M (IRAK-M) up-regulation.
15652352 CD44-mediated hyaluronan binding in myeloid cells is regulated by phosphorylated ERM and the actin cytoskeleton.
15645378 statistical relationship found between HPV16 infection and the expression of CD44v6 in esophageal squamous cell carcinoma
15641486 High CD44 expression is associated with colorectal carcinomas
15638386 CD44v10 takes part in local cancer progression. (CD44v10)
15638368 CD44 variant 4 may influence the progression of colorectal cancer.
15578568 modulating role of CD44 in osteoclast formation appears to depend on the microenvironment
15558018 The conserved binding ability of the Hemopexin domains suggests that CD44 may act as a core molecule assembling multiple Membrane-type 1 matrix metalloproteinases on the cell surface.
15531362 CD44 expression identifies astrocyte-restricted precursor cells.
15516973 Osteopontin protein-binding activity was inhibited by the CD44 blocking antibody.
15509527 CD44 variants have roles in a feedback loop in endothelial cells in human atheroma and abdominal aortic aneurysm
15361838 Recombinant CD44-hyaluronic acid binding domain represents a novel class of angiogenesis inhibitors based on a cell-surface receptor.
15313120 role in tumor induced angiogenesis
15292257 alpha2beta1 integrin and CD44/CSPG receptor binding on human melanoma cell activation has been evaluated herein using triple-helical peptide ligands incorporating collagen peptides.
15239258 CD44 expression in primary lesions is related to higher frequency of extrahepatic metastasis. This may be clinicopathologically useful parameter in predicting occurrence of distant metastasis.
15123640 Data suggest that hyaluronan-CD44 interaction with Rac1-protein kinase N gamma plays a pivotal role in phospholipase C gamma1-regulated calcium signaling and cortactin-cytoskeleton function required for keratinocyte cell-cell adhesion and differentiation.
15060082 The ability of TSG-6 to modulate the interaction of hyaluronan with CD44 has important implications for CD44-mediated cell activity at sites of inflammation, where TSG-6 is expressed.
15048167 CD44 was mainly expressed by the endothelial cells of high endothelial venules, fibroblasts in stromal compartments and large mononuclear cells.Its expression suggest that it participates in trafficking of leukocytes,especially lymphocytes to the omentum.
15040016 Heparanase, CD44v6 and nm23 may play important roles in the invasive infiltration and lymph node metastasis in gastric carcinomas
15023889 Maximal CD44 expression on isolated monocytes is decreased in patients with a poor collateralization compared with patients with a good collateralization.
15017146 NMR analysis of the hyaluronan-binding domain of CD44
15013310 CD44 expression in renal allografts correlates with renal function.
15009704 dermatan sulfate-CD44H proteoglycan is essential for fibroblast migration into fibrin clots and that platelet-derived growth factor, the stimulus for migration, induces the production of chondroitin-sulfate- and dermatan-sulfate-glycanated CD44H.
14981907 CD44 variant isoforms on 55 transitional cell carcinoma tissue specimens were examined and expression of CD44v5 was inversely related to tumor grade
14669354 Detection of PCNA and CD44mRNA expression in colorectal cancer may be useful for evaluating liver metastasis of cancer cells.
14644158 RhoA induced clustering of MMP-9 was observed in advancing lamellipodia at the forefront of endothelial cells, where this proteinase colocalized with RhoA and CD44
14623895 cleavage of CD44 catalyzed by ADAM10 is augmented by the intracellular signaling elicited by engagement of CD44, through Rac1-mediated cytoskeletal rearrangement, and suggest that CD44 cleavage contributes to the migration and invasion of tumor cells
14614016 high CD44 expression is associated with mucinous epithelial ovarian cancer
14534719 CD44v6 is upregulated in transformated colon cancer cells
14534711 CD44 v6 has a role in metastatic potential of carcinoma cells increasing the migration capacity and participating in invasion via changes in adhesion to the extracellular ligands, but is not necessary to modify the clinical history of the metastases
14504094 CD44-hyaluronic acid interactions may contribute to lymphocytotropism to skin in acute GVHD.
12949055 CD44v6 expression and cell adhesion in HepG2 cells depends on osteopontin
12928429 analysis of the hyaluronan recognition mode of CD44
12911725 We conclude that the cell adhesion molecule CD44 is expressed infrequently in papillary serous endometrial carcinoma.
12909589 CD44 is important for bronchial epithelial cell binding to hyaluronic acid and that cytokines known to be expressed in inflammation can increase binding independently of the level of CD44 expression.
12908752 The expression of CD44 standard in 30 oligodendrogliomas was studied in order to verify its possible prognostic role. CD44H could have prognostic value regarding the occurrence of relapses.
12893366 CD44 expression correlates with T stage in renal cell carcinoma, although this correlation does not reach statistical significance; no association of CD44 expression with survival is found in renal cell carcinoma patients who underwent nephrectomy.
12883358 Post-translational modification of CD44s represents the principal regulatory mechanism of CD44s-mediated functions in melanoma.
12842543 CD44v5 expression is independently positively correlated with the agressiveness of thymic epithelial tumors.
12826680 CD44 alternative v9 exon contains a splicing enhancer responsive to the SR proteins 9G8, ASF/SF2, and SRp20
12820426 Expressions of CD44s and CD44v6 play an important role in tumor progression.
12801931 hydrolysis by hyaluronan oligosaccharides
12779084 Higher relative expression of SR55 protein was associated with an altered pattern of CD44 variants incorporating exon v7 as determined by reverse transcription-polymerase chain reaction (RT-PCR) and Southern blot analysis.
12767055 The presence of Abeta 1-40 fragment, alone or in combination with IL1beta, induced an increase in the percentage of cells expressing CD44
12748184 CD44 interaction with p115RhoGEF and ROK plays a pivotal role in promoting Gab-1 phosphorylation leading to Gab-1.PI 3-kinase membrane localization, AKT signaling, and cytokine (M-CSF) production during HA-mediated breast cancer progression
12730955 that Src contributes in part to malignant peripheral nerve sheath tumor cell invasion by increasing CD44 levels.
12727228 Data demonstrate that blockade of the ERK pathway suppressed the expression of matrix metalloproteinases 3, 9, and 14, and CD44, and markedly inhibited the invasiveness of tumor cells.
12711360 Review. CD44 and ezrin and their respective complex have properties suggesting that they may be important in the process of tumour-endothelium interactions, cell migrations, cell adhesion, tumour progression and metastasis.
12702150 role of CD44 variant isoform v10 in adhesion of lymphocytes to melanoma cells
12650924 Crosslinking of CD44 on osteoblastic cells with specific antibodies augmented the expression of intercellular adhesion molecule (ICAM)-1 and vascular cell adhesion molecule (VCAM)-1
12635659 expressed by cells of the oligodendrocyte lineage in vitro and by oligodendrogliomas in vivo; could play a role in migration of tumor cells in oligodendrocytic tumors
12629514 Our present findings suggest important implications for understanding CD44-dependent signal transduction and a potential role of PS/gamma-secretase activity in the functional regulation of adhesion molecules.
12574156 CD44 interaction with the alpha 1(IV)1263-1277 region from basement membrane collagen is modulated by ligand glycosylation
12511569 regulation of interaction with hyaluronan by E-cadherin and role in mediating tumor invasion and branching morphogenesis
12508241 CD44 silencing is controlled in part by a complex and tumor cell-specific process involving hypermethylation of the CD44 gene promoter and exon 1 regions.
12506143 Crystal retention in human kidney may depend on expression of CD44 antigen-, osteopontin-, and hyaluronic acid-rich cell coats by damaged distal tubular epithelium.
12485845 Antagonistic signaling pathways regulate alternative splicing in T cells.
12479099 Increase of CD44s, MMP-9, and Ki-67 were involved in the growth and local invasion of osteosarcoma.
12452061 studied CD44v6 expression in intraductal papilloma, and its malignant transformation, intraductal breast carcinoma
12444143 Basic sequences in the cytoplasmic domains of PSGL-1, CD43, and CD44 are required for efficient association with HIV-1 Gag in HeLa cells
12439723 Butyrate significantly inhibited transcription of the CD44 gene and abolished epidermal growth factor-mediated up-regulation of the reporter gene luciferase subcloned upstream to the CD44 promoter (-1.1 kb) and transfected to HM7 cells
12421945 CD44 induction in THP-1 monocytic cells is the result of the distinct involvement of c-Jun N-terminal kinase (JNK) in lipopolysaccharide-mediated signaling and may require JNK-dependent activation of Egr-1.
12411303 results show that genes such as interleukin-6 (IL-6), IL-1alpha, and beta(2)-adrenergic receptor (beta(2)-AR) were specifically up-regulated by CD44 ligation, suggesting a novel role for CD44 in immunoregulation and inflammation
12407110 exon v10-encoded B[X(7)]B motif is solely responsible for the enhanced adhesive activity of exon v10-containing CD44 isoforms
12393872 Autocrine/paracrine prostaglandin E2 production by non-small cell lung cancer cells regulates antigen in cox-2-dependent invasion
12371152 reduction in the expression of CD44 may confer growth advantage and malignant properties to tumour cells
12297287 Engagement of CD44 either by its natural ligand hyaluronan or a specific antibody on a cell line induced tyrosine phosphorylation and activation of focal adhesion kinase.
12235127 Hyaluronan-CD44 interaction inhibits migration of osteoclast-like cells by down-regulating MMP-9.
12226094 CD44 spontaneously released from normal bronchial epithelial cells can accumulate as an integral component of the matrix, where it may play a role in the organization of matrices and in anchoring growth factors and chemokines to the matrix
12223485 Data suggest that intramembranous processing of CD44 occurs by a presenilin-1-dependent gamma-secretase activity at two distinct sites.
12198147 Initial steps of Shigella binding and cell entry depend on the cholesterol/sphingolipid raft-mediated CD44-IpaB interaction.
12183053 a signal transduction cascade or cross-talk emanating from CD44 to c-Met
12168806 CD44 has a functional role in inflammatory processes and tumor susceptibility
12145287 CD44 interaction with the TGF-betaRI kinase promotes activation of multiple signaling pathways required for ankyrin-membrane interaction, tumor cell migration, and oncogenic events during HA and TGF-beta-mediated metastatic breast tumor progression
12145196 CD44 directs membrane-type 1 matrix metalloproteinase to lamellipodia by associating with its hemopexin-like domain.
12090473 TNFalpha and IL-8 regulate the expression and function of CD44 variant proteins in human colon carcinoma cells.
12032545 A novel PKC-regulated mechanism controls CD44 ezrin association and directional cell motility.
11935029 In mice, CD44 plays a role in resolving the inflammatory response following lung injury by clearance of inflammatory hyaluronan fragments, clearance of apoptotic PMNs, and generation of active TGFbeta 1.
11840273 variant isoforms involved in plasma cell adhesion to bone marrow stromal cells and in the multiple myeloma disease process
11839564 wide prevalence of CD44 cleavage suggests that it plays an important role in the pathogenesis of human tumors
11825898 Three SIBLINGs (small integrin-binding ligand, N-linked glycoproteins) enhance factor H's cofactor activity enabling MCP-like cellular evasion of complement-mediated attack.
11792412 sCD44 levels could be a useful prognostic marker for aggressive lymphoma
11759056 results suggest that CD44S and CD44v5 are differentially expressed in early and advanced ovarian serous carcinomas and support previous studies that suggest a role for CD44 and stromal hyaluronic acid in the dissemination of ovarian epithelial cancer
11740562 cd44 dependent group A Streptococcus binding to keratinocytes induce cytoskeletal rearrangements
11727257 Expression in uterine smooth muscle tumors
11716065 Hyaluronate receptors mediate glioma cell migration and proliferation. The expression of the HA-receptors, CD44, and RHAMM, is virtually ubiquitous amongst glioma cell lines, and glioma tumor specimens.
11466334 Interaction of CD44 when cross-linked on rheumatoid synovial cells with hyaluronan fragments present in the surrounding extracellular matrix augments Fas expression and Fas-mediated apoptosis of synovial cells.

AA Sequence

MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKAL      1 - 70
SIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFD     71 - 140
GPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSP    141 - 210
WITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNE    211 - 280
ENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRN    281 - 350
GTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDS    351 - 420
HSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTG    421 - 490
LVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGY    491 - 560
TSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGS    561 - 630
QEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLN    631 - 700
GEASKSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV                                701 - 742
//

Text Mined References (922)

PMID Year Title
26974151 2016 Long Non-Coding RNA ucoo2kmd.1 Regulates CD44-Dependent Cell Growth by Competing for miR-211-3p in Colorectal Cancer.
26897523 2016 CD44-mediated monocyte transmigration across Cryptococcus neoformans-infected brain microvascular endothelial cells is enhanced by HIV-1 gp41-I90 ectodomain.
26823744 2015 CD44v6 down-regulation is an independent prognostic factor for poor outcome of colorectal carcinoma.
26762850 2016 Clinical relevance of CD44 surface expression in advanced stage serous epithelial ovarian cancer: a prospective study.
26708679 2016 CD44 promotes chemoresistance in T-ALL by increased drug efflux.
26687806 2016 ALDH(+)/CD44(+) cells in breast cancer are associated with worse prognosis and poor clinical outcome.
26647656 2016 CD44v3+/CD24- cells possess cancer stem cell-like properties in human oral squamous cell carcinoma.
26639196 2016 The homing receptor CD44 is involved in the progression of precancerous gastric lesions in patients infected with Helicobacter pylori and in development of mucous metaplasia in mice.
26621455 2016 The expression of CD44v6 in colon: from normal to malignant.
26617909 2015 Genetic association between CD44 polymorphisms and chronic hepatitis B virus infection in a Chinese Han population.
26617852 2015 Predictive value of CD44 and CD24 for prognosis and chemotherapy response in invasive breast ductal carcinoma.
26608413 2016 Immunohistochemical expression of cancer stem cell related markers CD44 and CD133 in endometrial cancer.
26597578 2016 Inhibition of Tumor Growth and Metastasis in Pancreatic Cancer Models by Interference With CD44v6 Signaling.
26575878 2015 [Expression and significance of adhesion molecules CD62P and CD44 in peripheral blood of infants with bronchiolitis].
26552644 2015 Overexpression of HOXA10 promotes gastric cancer cells proliferation and HOXA10(+)/CD44(+) is potential prognostic biomarker for gastric cancer.
26540347 2015 Knock out CD44 in reprogrammed liver cancer cell C3A increases CSCs stemness and promotes differentiation.
26517627 2015 Clinicopathological characterisation of duodenal adenocarcinoma with high CD44 variant 9 expression.
26449187 2015 ALDH/CD44 identifies uniquely tumorigenic cancer stem cells in salivary gland mucoepidermoid carcinomas.
26429859 2015 HDAC inhibitor AR-42 decreases CD44 expression and sensitizes myeloma cells to lenalidomide.
26423339 2016 Screening and Identification of a Phage Display Derived Peptide That Specifically Binds to the CD44 Protein Region Encoded by Variable Exons.
26420348 2015 The pattern of CD44 and matrix metalloproteinase 9 expression is a useful predictor of ulcerative colitis-associated dysplasia and neoplasia.
26418878 2015 The metastasis suppressor, NDRG1, inhibits "stemness" of colorectal cancer via down-regulation of nuclear ?-catenin and CD44.
26416034 2015 CD44 single nucleotide polymorphism and isoform switching may predict gastric cancer recurrence.
26408312 2015 Evaluation of the correlation of KAI1/CD82, CD44, MMP7 and ?-catenin in the prediction of prognosis and metastasis in colorectal carcinoma.
26356590 2015 Association of CD44 Gene Polymorphism with Survival of NSCLC and Risk of Bone Metastasis.
26299618 2015 CD44 promotes multi-drug resistance by protecting P-glycoprotein from FBXO21-mediated ubiquitination.
26298632 2015 The clinicopathological and prognostic significance of CD24, CD44, CD133, ALDH1 expressions in invasive ductal carcinoma of the breast: CD44/CD24 expression in breast cancer.
26289026 2015 MT1-MMP recognition by ERM proteins and its implication in CD44 shedding.
26287771 2015 Prognostic value of CD44 expression in renal cell carcinoma: a systematic review and meta-analysis.
26261555 2015 Expression of CD44 in pancreatic cancer and its significance.
26252284 2015 Meta-Analysis of Prognostic and Clinical Significance of CD44v6 in Esophageal Cancer.
26250934 2015 CD44 variant 6 is correlated with peritoneal dissemination and poor prognosis in patients with advanced epithelial ovarian cancer.
26218733 2015 Temporal lobe epilepsy patients with severe hippocampal neuron loss but normal hippocampal volume: Extracellular matrix molecules are important for the maintenance of hippocampal volume.
26189059 2015 CD44 enhances tumor aggressiveness by promoting tumor cell plasticity.
26181364 2015 Direct binding of hepatocyte growth factor and vascular endothelial growth factor to CD44v6.
26151392 2015 CD44 alternative splicing and hnRNP A1 expression are associated with the metastasis of breast cancer.
26134113 2015 Sulforaphane inhibits invasion by phosphorylating ERK1/2 to regulate E-cadherin and CD44v6 in human prostate cancer DU145 cells.
26124272 2015 Quantitative Characterization of E-selectin Interaction with Native CD44 and P-selectin Glycoprotein Ligand-1 (PSGL-1) Using a Real Time Immunoprecipitation-based Binding Assay.
26119931 2016 Regulation of CD44E by DARPP-32-dependent activation of SRp20 splicing factor in gastric tumorigenesis.
26079799 2015 CD44 is a direct target of miR-199a-3p and contributes to aggressive progression in osteosarcoma.
26079538 2015 AF1q is a novel TCF7 co-factor which activates CD44 and promotes breast cancer metastasis.
26077342 2015 A self-enforcing CD44s/ZEB1 feedback loop maintains EMT and stemness properties in cancer cells.
26067154 2015 The homeoprotein DLX4 stimulates NF-?B activation and CD44-mediated tumor-mesothelial cell interactions in ovarian cancer.
26025397 2015 Importance of CD44 on umbilical cord mesenchymal stem cells for expansion of hematopoietic cells.
26010608 2015 Functional Genetic Variations at the microRNA Binding-Site in the CD44 Gene Are Associated with Risk of Colorectal Cancer in Chinese Populations.
25979842 2015 CD44 regulates cell proliferation, migration, and invasion via modulation of c-Src transcription in human breast cancer cells.
25975956 2015 Relevance of ?Gal-?GalNAc-containing glycans and the enzymes involved in their synthesis for invasion and survival in breast cancer patients.
25971596 2015 CD44 expression contributes to trastuzumab resistance in HER2-positive breast cancer cells.
25950774 2015 CD44 and CXCL9 serum protein levels predict the risk of clinically significant allograft rejection after liver transplantation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25937513 2015 CD44S-hyaluronan interactions protect cells resulting from EMT against anoikis.
25929323 2015 Expression of ezrin, CD44, and VEGF in giant cell tumor of bone and its significance.
25909162 2015 Cleaved CD44 intracellular domain supports activation of stemness factors and promotes tumorigenesis of breast cancer.
25888636 2015 CD44 increases the efficiency of distant metastasis of breast cancer.
25886575 2015 Induction of tumor initiation is dependent on CD44s in c-Met? hepatocellular carcinoma.
25864644 2015 CD44 knock-down in bovine and human chondrocytes results in release of bound HYAL2.
25850653 2015 Alternative CD44 splicing identifies epithelial prostate cancer cells from the mesenchymal counterparts.
25840418 2015 NGF-induced TrkA/CD44 association is involved in tumor aggressiveness and resistance to lestaurtinib.
25826491 2015 E-cadherin÷CD44 immunophenotype in the epithelial-mesenchymal transition of bladder urothelial carcinomas.
25823654 2015 Up-regulation of CD44 in the development of metastasis, recurrence and drug resistance of ovarian cancer.
25813380 2015 Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.
25809603 2015 Cell membrane CD44v6 levels in squamous cell carcinoma of the lung: association with high cellular proliferation and high concentrations of EGFR and CD44v5.
25809479 2015 Interleukin-1?-induced Reduction of CD44 Ser-325 Phosphorylation in Human Epidermal Keratinocytes Promotes CD44 Homomeric Complexes, Binding to Ezrin, and Extended, Monocyte-adhesive Hyaluronan Coats.
25804234 2015 ?D44+/CD24- markers of cancer stem cells in patients with breast cancer of different molecular subtypes.
25791790 2015 Increased Expression of Circulating Cancer Stem Cell Markers During the Perioperative Period Predicts Early Recurrence After Curative Resection of Hepatocellular Carcinoma.
25772760 2015 Self-renewal and circulating capacities of metastatic hepatocarcinoma cells required for collaboration between TM4SF5 and CD44.
25762343 2015 CD44 Isoform Status Predicts Response to Treatment with Anti-CD44 Antibody in Cancer Patients.
25737167 2015 CD44 as a potential diagnostic tumor marker.
25711649 2015 Soluble CD44 concentration in the serum and peritoneal fluid samples of patients with different stages of endometriosis.
25710579 Prognostic Significance of CD44v6, CD133, CD166, and ALDH1 Expression in Small Intestinal Adenocarcinoma.
25708025 2015 Lubricin/Proteoglycan 4 Binding to CD44 Receptor: A Mechanism of the Suppression of Proinflammatory Cytokine-Induced Synoviocyte Proliferation by Lubricin.
25693083 2014 Expression of stem cell marker CD44 in prostate cancer biopsies predicts cancer grade in radical prostatectomy specimens.
25683728 2015 FOXP3 suppresses breast cancer metastasis through downregulation of CD44.
25683512 2015 IL-17 and insulin/IGF1 enhance adhesion of prostate cancer cells to vascular endothelial cells through CD44-VCAM-1 interaction.
25681441 2015 Lysosomal degradation of CD44 mediates ceramide nanoliposome-induced anoikis and diminished extravasation in metastatic carcinoma cells.
25659582 2015 Mitochondrial SOD2 regulates epithelial-mesenchymal transition and cell populations defined by differential CD44 expression.
25658794 2015 Expression and significance of CD44, CD47 and c-met in ovarian clear cell carcinoma.
25656929 2015 Overlap of CD44 expression between prostatic small cell carcinoma and acinar adenocarcinoma.
25656374 2015 Down-regulation of ALDH1A3, CD44 or MDR1 sensitizes resistant cancer cells to FAK autophosphorylation inhibitor Y15.
25627085 2015 Interaction of tetraspan(in) TM4SF5 with CD44 promotes self-renewal and circulating capacities of hepatocarcinoma cells.
25625240 2015 Colon cancer stem cell markers CD44 and CD133 in patients with colorectal cancer and synchronous hepatic metastases.
25623890 2015 hnRNP L inhibits CD44 V10 exon splicing through interacting with its upstream intron.
25605020 2015 Adhesion glycoprotein CD44 functions as an upstream regulator of a network connecting ERK, AKT and Hippo-YAP pathways in cancer progression.
25596560 2015 Reversibly crosslinked hyaluronic acid nanoparticles for active targeting and intelligent delivery of doxorubicin to drug resistant CD44+ human breast tumor xenografts.
25582385 2015 Expression of CD44 and CD35 during normal and myelodysplastic erythropoiesis.
25576211 2015 CD44-SLC1A2 fusion transcripts in primary colorectal cancer.
25571897 2015 Clinical significance of CD44s, CD44v3 and CD44v6 in breast cancer.
25566991 2015 CD44 regulates pancreatic cancer invasion through MT1-MMP.
25551284 2014 MicroRNA-34a functions as an anti-metastatic microRNA and suppresses angiogenesis in bladder cancer by directly targeting CD44.
25550556 2015 Cancer stem cell marker in circulating tumor cells: expression of CD44 variant exon 9 is strongly correlated to treatment refractoriness, recurrence and prognosis of human colorectal cancer.
25515492 2015 Cluster of Differentiation 44 Targeted Hyaluronic Acid Based Nanoparticles for MDR1 siRNA Delivery to Overcome Drug Resistance in Ovarian Cancer.
25483103 2015 A switch from CD44? cell to EMT cell drives the metastasis of prostate cancer.
25481101 2015 Pancreatic cancer cells express CD44 variant 9 and multidrug resistance protein 1 during mitosis.
25479940 2015 Chronic inflammation with Helicobacter pylori infection is implicated in CD44 overexpression through miR-328 suppression in the gastric mucosa.
25471937 2014 SMURF1 silencing diminishes a CD44-high cancer stem cell-like population in head and neck squamous cell carcinoma.
25461272 2015 Impacts of CD44 knockdown in cancer cells on tumor and host metabolic systems revealed by quantitative imaging mass spectrometry.
25449226 2015 Transglutaminase 2 interacts with syndecan-4 and CD44 at the surface of human macrophages to promote removal of apoptotic cells.
25447529 2014 CD44 variant, but not standard CD44 isoforms, mediate disassembly of endothelial VE-cadherin junction on metastatic melanoma cells.
25408361 2015 Bone marrow stromal cells protect acute myeloid leukemia cells from anti-CD44 therapy partly through regulating PI3K/Akt-p27(Kip1) axis.
25400809 2014 MiR-199a inhibits the ability of proliferation and migration by regulating CD44-Ezrin signaling in cutaneous squamous cell carcinoma cells.
25400792 2014 Granulocyte colony-stimulating factor-producing undifferentiated carcinoma of the colon mimicking a pulmonary giant cell carcinoma: a case showing overexpression of CD44 along with highly proliferating nestin-positive tumor vessels.
25369610 2015 There is no change in soluble leucocyte selectin concentrations in whole blood after 48 hours of storage at 4 °C.
25339657 2015 CD44 variant isoforms expressed by breast cancer cells are functional E-selectin ligands under flow conditions.
25335738 2014 Clinical significance of putative cancer stem cell marker CD44 in different histological subtypes of lung cancer.
25325984 2015 Analysis of human hyaluronan synthase gene transcriptional regulation and downstream hyaluronan cell surface receptor mobility in myofibroblast differentiation.
25301071 2015 CD44 functions in Wnt signaling by regulating LRP6 localization and activation.
25283845 2015 Transcriptomic profiling of human choriodecidua during term labor: inflammation as a key driver of labor.
25277524 2014 Long noncoding RNA GAPLINC regulates CD44-dependent cell invasiveness and associates with poor prognosis of gastric cancer.
25269647 2014 Zerumbone suppresses EGF-induced CD44 expression through the inhibition of STAT3 in breast cancer cells.
25268088 2014 Two polymorphisms of CD44 3'UTR weaken the binding of miRNAs and associate with naso-pharyngeal carcinoma in a Chinese population.
25194445 2014 The prognostic value of CD44 expression in gastric cancer: a meta-analysis.
25184276 2014 NF-?B affects proliferation and invasiveness of breast cancer cells by regulating CD44 expression.
25169522 2014 Prognostic value of CD44 variant exon 6 expression in non-small cell lung cancer: a meta-analysis.
25169209 2015 Brain metastasis is predetermined in early stages of cutaneous melanoma by CD44v6 expression through epigenetic regulation of the spliceosome.
25168019 2015 Aberrant expression of cancer stem cell markers (CD44, CD90, and CD133) contributes to disease progression and reduced survival in hepatoblastoma patients: 4-year survival data.
25143125 2014 Nested and microcystic variants of urothelial carcinoma displaying immunohistochemical features of basal-like urothelial cells: an immunohistochemical and histopathogenetic study.
25138157 2014 Melanoma upregulates ICAM-1 expression on endothelial cells through engagement of tumor CD44 with endothelial E-selectin and activation of a PKC?-p38-SP-1 pathway.
25138066 2014 Hyalurosome gene regulation and dose-dependent restoration of skin atrophy by retinaldehyde and defined-size hyaluronate fragments in dermatoporosis.
25129125 2015 CD44 expression in curettage and postoperative specimens of endometrial cancer.
25126764 2014 Low molecular weight hyaluronan mediated CD44 dependent induction of IL-6 and chemokines in human dermal fibroblasts potentiates innate immune response.
25123505 2015 Expression of TNF-? and CD44 is implicated in poor prognosis, cancer cell invasion, metastasis and resistance to the sunitinib treatment in clear cell renal cell carcinomas.
25120740 2014 Prognostic value of CD44 expression in non-small cell lung cancer: a systematic review.
25116630 2014 Terminal sialic acids on CD44 N-glycans can block hyaluronan binding by forming competing intramolecular contacts with arginine sidechains.
25101858 2014 CD44 acts through RhoA to regulate YAP signaling.
25094049 2014 Cluster of differentiation 166 (CD166) regulates cluster of differentiation (CD44) via NF-?B in liver cancer cell line Bel-7402.
25081533 2014 Hyaluronan-CD44 interaction promotes oncogenic signaling, microRNA functions, chemoresistance, and radiation resistance in cancer stem cells leading to tumor progression.
25081532 2014 CD44 is a multidomain signaling platform that integrates extracellular matrix cues with growth factor and cytokine signals.
25081531 2014 HAS2 and CD44 in breast tumorigenesis.
25076245 Expression of CD44v3, erythropoietin and VEGF-C in gastric adenocarcinomas: correlations with clinicopathological features.
25064733 2014 Evaluation of soluble CD44 protein marker to distinguish the premalignant and malignant carcinoma cases in cervical cancer patients.
25060796 2014 Osteopontin-CD44v6 interaction mediates calcium deposition via phospho-Akt in valve interstitial cells from patients with noncalcified aortic valve sclerosis.
25053293 2015 A mesenchymal-like phenotype and expression of CD44 predict lack of apoptotic response to sorafenib in liver tumor cells.
25031744 2014 Concurrent CD44s and STAT3 expression in human clear cell renal cellular carcinoma and its impact on survival.
25009318 2014 Genetic association of osteopontin (OPN) and its receptor CD44 genes with susceptibility to Chinese gastric cancer patients.
24998585 2014 CD44v3 and VEGF-C expression and its relationship with lymph node metastasis in squamous cell carcinomas of the uterine cervix.
24990559 2014 Challenging the roles of CD44 and lipolysis stimulated lipoprotein receptor in conveying Clostridium perfringens iota toxin cytotoxicity in breast cancer.
24971320 2014 CD44 gene polymorphisms on hepatocellular carcinoma susceptibility and clinicopathologic features.
24962319 2014 CD44-mediated adhesion to hyaluronic acid contributes to mechanosensing and invasive motility.
24960658 2015 Molecular typing for the Indian blood group associated 252G>C single nucleotide polymorphism in a selected cohort of Australian blood donors.
24960044 2014 Decreased camptothecin sensitivity of the stem-cell-like fraction of Caco2 cells correlates with an altered phosphorylation pattern of topoisomerase I.
24920554 2014 Co-expression of CD133, CD44v6 and human tissue factor is associated with metastasis and poor prognosis in pancreatic carcinoma.
24916930 2014 CD44 and RHAMM hyaluronan receptors in human ocular surface inflammation.
24912773 2014 Structural basis of DDB1-and-Cullin 4-associated Factor 1 (DCAF1) recognition by merlin/NF2 and its implication in tumorigenesis by CD44-mediated inhibition of merlin suppression of DCAF1 function.
24884875 2014 Cisplatin-resistant cells in malignant pleural mesothelioma cell lines show ALDH(high)CD44(+) phenotype and sphere-forming capacity.
24864242 2014 Immunohistochemical detection of cancer stem cell related markers CD44 and CD133 in metastatic colorectal cancer patients.
24860093 2014 Platelet-derived growth factor ?-receptor, transforming growth factor ? type I receptor, and CD44 protein modulate each other's signaling and stability.
24839953 2014 Coexpression of CD44-positive/CD133-positive cancer stem cells and CD204-positive tumor-associated macrophages is a predictor of survival in pancreatic ductal adenocarcinoma.
24832177 2015 Expression profile of standard and variants forms of CD44 related to prostate cancer behavior.
24823486 2014 Activation of c-Met and upregulation of CD44 expression are associated with the metastatic phenotype in the colorectal cancer liver metastasis model.
24739401 2014 The addition of rituximab to CHOP therapy alters the prognostic significance of CD44 expression.
24739387 2014 A novel CD44-binding peptide from the pro-matrix metalloproteinase-9 hemopexin domain impairs adhesion and migration of chronic lymphocytic leukemia (CLL) cells.
24727741 2014 Coexpression of EpCAM, CD44 variant isoforms and claudin-7 in anaplastic thyroid carcinoma.
24726313 2014 Detection of bladder cancer by measuring CD44v6 expression in urine with real-time quantitative reverse transcription polymerase chain reaction.
24716927 2014 ALDH1 in combination with CD44 as putative cancer stem cell markers are correlated with poor prognosis in urothelial carcinoma of the urinary bladder.
24716905 2014 Correlation between expression of cell adhesion molecules CD?? v6 and E-cadherin and lymphatic metastasis in non- small cell lung cancer.
24715151 2014 Doxorubicin induces drug resistance and expression of the novel CD44st via NF-?B in human breast cancer MCF-7 cells.
24709425 2014 Lung-derived factors mediate breast cancer cell migration through CD44 receptor-ligand interactions in a novel ex vivo system for analysis of organ-specific soluble proteins.
24708709 2014 CD44v/CD44s expression patterns are associated with the survival of pancreatic carcinoma patients.
24699672 2014 CD44 gene polymorphisms and environmental factors on oral cancer susceptibility in Taiwan.
24680978 2014 Polymorphism of CD44 influences the efficacy of CD34(+) cells mobilization in patients with hematological malignancies.
24655565 2014 Exemestane blocks mesothelioma growth through downregulation of cAMP, pCREB and CD44 implicating new treatment option in patients affected by this disease.
24647926 2014 IMP3 combined with CD44s, a novel predictor for prognosis of patients with hepatocellular carcinoma.
24647137 2014 Clinical and prognostic significance of HIF-1?, PTEN, CD44v6, and survivin for gastric cancer: a meta-analysis.
24631171 2014 Expression and prognostic significance of cancer stem cell markers CD24 and CD44 in urothelial bladder cancer xenografts and patients undergoing radical cystectomy.
24619956 2015 Autocrine fibroblast growth factor 18 signaling mediates Wnt-dependent stimulation of CD44-positive human colorectal adenoma cells.
24618343 2014 CD44v8-10 is a cancer-specific marker for gastric cancer stem cells.
24614402 2014 Knock-down of CD44 regulates endothelial cell differentiation via NF?B-mediated chemokine production.
24607407 2014 Osteopontin-CD44 signaling in the glioma perivascular niche enhances cancer stem cell phenotypes and promotes aggressive tumor growth.
24607406 2014 CD44v6 is a marker of constitutive and reprogrammed cancer stem cells driving colon cancer metastasis.
24606718 2014 Hyaluronan-CD44 interaction promotes c-Jun signaling and miRNA21 expression leading to Bcl-2 expression and chemoresistance in breast cancer cells.
24604526 2014 CD44 affects the expression level of FOS?like antigen 1 in cervical cancer tissues.
24583847 2014 Activation of VCAM-1 and its associated molecule CD44 leads to increased malignant potential of breast cancer cells.
24526308 2014 Regulatory factor X1 is a new tumor suppressive transcription factor that acts via direct downregulation of CD44 in glioblastoma.
24512624 2014 A novel mechanism of regulating breast cancer cell migration via palmitoylation-dependent alterations in the lipid raft affiliation of CD44.
24504189 2014 Expression of the cancer stem cell markers CD44v6 and ABCG2 in tongue cancer: effect of neoadjuvant chemotherapy on local recurrence.
24491153 2014 Increased CD44s and decreased CD44v6 RNA expression are associated with better survival in myxofibrosarcoma patients: a pilot study.
24482053 2014 Clinicopathologic significance of Sox2, CD44 and CD44v6 expression in intrahepatic cholangiocarcinoma.
24468288 2014 Expression profile of CD44s, CD44v6, and CD44v10 in localized prostate cancer: effect on prognostic outcomes following radical prostatectomy.
24455718 2013 ?V ?5 and CD44 are oxygen-regulated human embryonic stem cell attachment factors.
24450601 2014 Correlation of ALDH1, CD44, OCT4 and SOX2 in tongue squamous cell carcinoma and their association with disease progression and prognosis.
24434427 2014 CD44 targets Na(+)/H(+) exchanger 1 to mediate MDA-MB-231 cells' metastasis via the regulation of ERK1/2.
24434386 2014 Expression of CD44 and P53 in renal cell carcinoma: association with tumor subtypes.
24429392 2014 CD44 expression is predictive of poor prognosis in pharyngolaryngeal cancer: systematic review and meta-analysis.
24410905 2014 Significance of CD44 expression in head and neck cancer: a systemic review and meta-analysis.
24406795 2014 Extensive CD44-dependent hyaluronan coats on human bone marrow-derived mesenchymal stem cells produced by hyaluronan synthases HAS1, HAS2 and HAS3.
24403253 2013 ADAM17-mediated CD44 cleavage promotes orasphere formation or stemness and tumorigenesis in HNSCC.
24397969 2014 Antibody against CD44s inhibits pancreatic tumor initiation and postradiation recurrence in mice.
24366074 2014 The role of CD44+/CD24-/low biomarker for screening, diagnosis and monitoring of breast cancer.
24363164 2014 CD44 and CD24 cannot act as cancer stem cell markers in human lung adenocarcinoma cell line A549.
24333422 2014 Inversed relationship between CD44 variant and c-Myc due to oxidative stress-induced canonical Wnt activation.
24324613 2013 Rb suppresses collective invasion, circulation and metastasis of breast cancer cells in CD44-dependent manner.
24324260 2014 Overexpression of c-Met and CD44v6 receptors contributes to autocrine TGF-?1 signaling in interstitial lung disease.
24318997 2014 Macrophage-derived reactive oxygen species suppress miR-328 targeting CD44 in cancer cells and promote redox adaptation.
24300972 2014 CD44s signals the acquisition of the mesenchymal phenotype required for anchorage-independent cell survival in hepatocellular carcinoma.
24276281 2014 CD44 is prognostic for overall survival in the NCI randomized trial on breast conservation with 25 year follow-up.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24194636 2013 sCD44 overexpression increases intraocular pressure and aqueous outflow resistance.
24186075 2014 Association of genetic variants of cancer stem cell gene CD44 haplotypes with gallbladder cancer susceptibility in North Indian population.
24173428 2014 SC35 promotes splicing of the C5-V6-C6 isoform of CD44 pre-mRNA.
24167614 2013 Triple negative breast tumors in African-American and Hispanic/Latina women are high in CD44+, low in CD24+, and have loss of PTEN.
24157443 2014 CD44 mediated hyaluronan adhesion of Toxoplasma gondii-infected leukocytes.
24156023 2013 Absent/weak CD44 intensity and positive human papillomavirus (HPV) status in oropharyngeal squamous cell carcinoma indicates a very high survival.
24132924 2013 HAb18G/CD147 promotes pSTAT3-mediated pancreatic cancer development via CD44s.
24122205 2014 Characterization of CD44 variant expression in head and neck squamous cell carcinomas.
24099991 2014 Hyaluronan synthase 1 (HAS1) produces a cytokine-and glucose-inducible, CD44-dependent cell surface coat.
24091662 2013 Opposing effects of high- and low-molecular weight hyaluronan on CXCL12-induced CXCR4 signaling depend on CD44.
24084461 2013 Significance of adhesion molecules expression for estimation of serous ovarian cancer prognosis.
24069351 2013 Hyaluronan-CD44 interaction promotes growth of decidual stromal cells in human first-trimester pregnancy.
24064218 2013 ETS-1-mediated transcriptional up-regulation of CD44 is required for sphingosine-1-phosphate receptor subtype 3-stimulated chemotaxis.
24038513 2015 Functional polymorphisms in the CD44 gene and acute myeloid leukemia cancer risk in a Chinese population.
24019906 2013 The CD44(high) tumorigenic subsets in lung cancer biospecimens are enriched for low miR-34a expression.
24019861 2013 Expression of COX-2, CD44v6 and CD147 and relationship with invasion and lymph node metastasis in hypopharyngeal squamous cell carcinoma.
24010665 2013 CD44 receptor unfolding enhances binding by freeing basic amino acids to contact carbohydrate ligand.
24009708 2013 CD44 expression in intestinal epithelium and colorectal cancer is independent of p53 status.
24005673 2013 Inter-?-inhibitor impairs TSG-6-induced hyaluronan cross-linking.
24004467 2013 Expression of CD44v6 and integrin-?1 for the prognosis evaluation of pancreatic cancer patients after cryosurgery.
23964856 2013 Study of the interaction among Notch pathway receptors, correlation with stemness, as well as their interaction with CD44, dipeptidyl peptidase-IV, hepatocyte growth factor receptor and the SETMAR transferase, in colon cancer stem cells.
23940692 2013 CD44 gene polymorphisms in breast cancer risk and prognosis: a study in North Indian population.
23900701 2013 Clinical implications of Ezrin and CD44 co?expression in breast cancer.
23889297 2013 Expression of moesin and CD44 is associated with poor prognosis in gastric adenocarcinoma.
23888049 2013 CD147, CD44, and the epidermal growth factor receptor (EGFR) signaling pathway cooperate to regulate breast epithelial cell invasiveness.
23884413 2013 Intracellular domain fragment of CD44 alters CD44 function in chondrocytes.
23883608 2013 Polymorphisms of CD44 gene and nasopharyngeal carcinoma susceptibility in a Chinese population.
23856463 2013 A link between two tumorigenic proteins, CD44 and p21WAF1: CD44 increases phorbol ester-induced expression of p21WAF1 by stabilizing its mRNA and extending protein half-life.
23855374 2013 Role of moesin in hyaluronan induced cell migration in glioblastoma multiforme.
23848514 2013 Functional role of CD44v-xCT system in the development of spasmolytic polypeptide-expressing metaplasia.
23837451 2013 CD44 as a molecular marker to screen cancer stem cells in hypopharyngeal cancer.
23835592 2014 CD44/CD24 as potential prognostic markers in node-positive invasive ductal breast cancer patients treated with adjuvant chemotherapy.
23803658 2013 CD44 is associated with the aggressive phenotype of nasopharyngeal carcinoma through redox regulation.
23800986 2013 CD44variant exon 9 plays an important role in colon cancer initiating cells.
23797812 2013 Evaluating stem and cancerous biomarkers in CD15+CD44+ KYSE30 cells.
23778530 2013 CD44 variant 9 expression in primary early gastric cancer as a predictive marker for recurrence.
23768762 2013 CD44 and SSEA-4 positive cells in an oral cancer cell line HSC-4 possess cancer stem-like cell characteristics.
23764310 2013 High TFAP2C/low CD44 expression is associated with an increased rate of pathologic complete response following neoadjuvant chemotherapy in breast cancer.
23744486 2013 Analysis of expression of membrane-bound tumor markers in ductal carcinoma in situ of the breast: paving the way for molecular imaging.
23736812 2013 Epigenetic modulation of signal transduction pathways in HPV-associated HNSCC.
23685894 2013 Immunohistochemical levels of matrix metalloproteinase-2 and CD44 variant 6 protein in the diagnosis and lateral cervical lymph node metastasis of papillary thyroid carcinoma.
23681900 2014 CD44/cellular prion protein interact in multidrug resistant breast cancer cells and correlate with responses to neoadjuvant chemotherapy in breast cancer patients.
23679813 2013 Histological and prognostic importance of CD44(+) /CD24(+) /EpCAM(+) expression in clinical pancreatic cancer.
23667174 2013 Stress-response protein RBM3 attenuates the stem-like properties of prostate cancer cells by interfering with CD44 variant splicing.
23665041 2013 Activated human hepatic stellate cells induce myeloid derived suppressor cells from peripheral blood monocytes in a CD44-dependent fashion.
23664487 2013 CD44 standard form expression is correlated with high-grade and advanced-stage ovarian carcinoma but not prognosis.
23653392 2014 Possible involvement of CD10 in the development of endometriosis due to its inhibitory effects on CD44-dependent cell adhesion.
23645762 2013 Clinical significances of cancer stem cells markers in patients with intrahepatic cholangiocarcinoma who underwent hepatectomy.
23633482 2013 Cancer stem-like cell marker CD44 promotes bone metastases by enhancing tumorigenicity, cell motility, and hyaluronan production.
23609373 2013 Clinicopathologic significance of putative stem cell marker, CD44 and CD133, in human gastric carcinoma.
23603511 2013 CD44 binds to macrophage mannose receptor on lymphatic endothelium and supports lymphocyte migration via afferent lymphatics.
23600676 2013 CD24 and CD44 in salivary gland pleomorphic adenoma and in human salivary gland morphogenesis: differential markers of glandular structure or stem cell indicators?
23589310 2013 The hyaluronic acid receptor CD44 coordinates normal and metaplastic gastric epithelial progenitor cell proliferation.
23589287 2013 Transforming growth factor-?1 (TGF-?1)-stimulated fibroblast to myofibroblast differentiation is mediated by hyaluronan (HA)-facilitated epidermal growth factor receptor (EGFR) and CD44 co-localization in lipid rafts.
23565227 2013 Silencing of CD44 gene expression in human 143-B osteosarcoma cells promotes metastasis of intratibial tumors in SCID mice.
23553902 2013 Brief report: CD24 and CD44 mark human intestinal epithelial cell populations with characteristics of active and facultative stem cells.
23549458 2013 CD44v6 expression in human skin keratinocytes as a possible mechanism for carcinogenesis associated with chronic arsenic exposure.
23547049 2013 CD44 regulates the apoptotic response and promotes disease development in chronic lymphocytic leukemia.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23476138 2013 Promising noninvasive cellular phenotype in prostate cancer cells knockdown of matrix metalloproteinase 9.
23463035 2013 A case of atypical fibrous histiocytoma with positivity for CD163 and CD44.
23457460 2013 The anti-migratory effects of FKBPL and its peptide derivative, AD-01: regulation of CD44 and the cytoskeletal pathway.
23449937 2013 Hyaluronan initiates chondrogenesis mainly via CD44 in human adipose-derived stem cells.
23445749 2013 Immunohistochemical expression of CD44s in human neuroblastic tumors: Moroccan experience and highlights on current data.
23444222 2013 CD44 and OTP are strong prognostic markers for pulmonary carcinoids.
23435135 2012 Prognostic significance of CD44 and c-erb-B2 protein overexpression in patients with gastric cancer.
23426175 2013 Sphingosine kinase 1 plays a role in the upregulation of CD44 expression through extracellular signal-regulated kinase signaling in human colon cancer cells.
23422486 No compensation in CD44 stem cell marker following BCL-2 suppression by antisense oligonucleotides.
23419168 2013 CD44/CD24 immunophenotypes on clinicopathologic features of salivary glands malignant neoplasms.
23404221 2013 CD44v6 expression is related to mesenchymal phenotype and poor prognosis in patients with colorectal cancer.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23373240 2012 [Correlation study between OPN, CD44v6, MMP-9 and distant metastasis in laryngeal squamous cell carcinoma].
23342032 2013 Demonstration of a melanoma-specific CD44 alternative splicing pattern that remains qualitatively stable, but shows quantitative changes during tumour progression.
23334333 2013 Redox regulation in stem-like cancer cells by CD44 variant isoforms.
23326564 2013 Targeting CD44-STAT3 signaling by Gemini vitamin D analog leads to inhibition of invasion in basal-like breast cancer.
23314380 2013 miR-34a inhibits the metastasis of osteosarcoma cells by repressing the expression of CD44.
23283480 2013 Expression of CD44 in articular cartilage is associated with disease severity in knee osteoarthritis.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23265944 2013 CD44 interacts with EGFR and promotes head and neck squamous cell carcinoma initiation and progression.
23263849 2013 CD44 and CD27 expression pattern in B cell precursor acute lymphoblastic leukemia and its clinical significance.
23252868 2012 Expression of the potential cancer stem cell markers, CD133, CD44, ALDH1, and ?-catenin, in primary lung adenocarcinoma--their prognostic significance.
23251004 2013 Reciprocal interactions between tumor-associated macrophages and CD44-positive cancer cells via osteopontin/CD44 promote tumorigenicity in colorectal cancer.
23238743 2013 High CD44s expression is associated with the EMT expression profile and intrahepatic dissemination of hepatocellular carcinoma after local ablation therapy.
23226410 2012 Cell specific CD44 expression in breast cancer requires the interaction of AP-1 and NF?B with a novel cis-element.
23221384 2013 Moesin is a glioma progression marker that induces proliferation and Wnt/?-catenin pathway activation via interaction with CD44.
23220849 2013 Differential immunohistochemical expression of CD44s, E-cadherin and ?-catenin among hyperplastic and neoplastic lesions of the prostate gland.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23171677 2013 High frequency of putative ovarian cancer stem cells with CD44/CK19 coexpression is associated with decreased progression-free intervals in patients with recurrent epithelial ovarian cancer.
23170789 2013 Factor VIIa regulates the expression of caspase-3, MMP-9, and CD44 in SW620 colon cancer cells involving PAR2/MAPKs/NF-?B signaling pathways.
23169460 2013 CD44 enhances tumor formation and lung metastasis in experimental osteosarcoma and is an additional predictor for poor patient outcome.
23160198 2012 HIV-1 infection-induced apoptotic microparticles inhibit human DCs via CD44.
23151220 2012 Characteristics of CD44 alternative splice pattern in the course of human colorectal adenocarcinoma progression.
23143465 2013 CD44 expression in intraoral salivary ductal papillomas and oral papillary squamous cell carcinoma.
23138176 2013 Ovarian cancer stem cells: working towards the root of stemness.
23118219 2012 The high and low molecular weight forms of hyaluronan have distinct effects on CD44 clustering.
23112116 2013 Cancer stem cells markers CD44, CD24 and ALDH1 in breast cancer special histological types.
23098472 2012 Prognostic significance of CD44v6/v7 in acute promyelocytic leukemia.
23089492 2013 Preferential up-regulation of osteopontin in primary central nervous system lymphoma does not correlate with putative receptor CD44v6 or CD44H expression.
23071680 2012 ?6 Integrin and CD44 enrich for a primary keratinocyte population that displays resistance to UV-induced apoptosis.
23056168 2012 PDGF suppresses the sulfation of CD44v and potentiates CD44v-mediated binding of colon carcinoma cells to fibrin under flow.
23049743 2012 A CD44high/EGFRlow subpopulation within head and neck cancer cell lines shows an epithelial-mesenchymal transition phenotype and resistance to treatment.
23039365 2012 Overexpression of CD44 accompanies acquired tamoxifen resistance in MCF7 cells and augments their sensitivity to the stromal factors, heregulin and hyaluronan.
23031255 2012 Lipid raft association restricts CD44-ezrin interaction and promotion of breast cancer cell migration.
23028444 2012 In situ identification of CD44+/CD24- cancer cells in primary human breast carcinomas.
23002207 2012 Induction of the stem-like cell regulator CD44 by Rho kinase inhibition contributes to the maintenance of colon cancer-initiating cells.
22972620 2012 Prognostic value of CD44 expression in penile squamous cell carcinoma: a pilot study.
22969228 2012 Lack of CD44 variant 6 expression in rectal cancer invasive front associates with early recurrence.
22967445 2012 [Expression of ezrin in human non-small cell lung cancer and its relationship with metastasis and prognosis].
22966907 2012 Integrin ?v?3 and CD44 pathways in metastatic prostate cancer cells support osteoclastogenesis via a Runx2/Smad 5/receptor activator of NF-?B ligand signaling axis.
22947857 2012 Distinct kinetic and molecular requirements govern CD44 binding to hyaluronan versus fibrin(ogen).
22932199 2012 Expression of CD44v6 and Livin in gastric cancer tissue.
22923171 2012 Suppression of tunicamycin-induced CD44v6 ectodomain shedding and apoptosis is correlated with temporal expression patterns of active ADAM10, MMP-9 and MMP-13 proteins in Caki-2 renal carcinoma cells.
22923071 2012 Clinical significance of LGR5 and CD44 expression in locally advanced rectal cancer after preoperative chemoradiotherapy.
22922740 2012 Enhanced membrane-type 1 matrix metalloproteinase expression by hyaluronan oligosaccharides in breast cancer cells facilitates CD44 cleavage and tumor cell migration.
22901285 2012 Protein markers of cancer-associated fibroblasts and tumor-initiating cells reveal subpopulations in freshly isolated ovarian cancer ascites.
22895075 2012 CD44 ligation with A3D8 antibody induces apoptosis in acute myeloid leukemia cells through binding to CD44s and clustering lipid rafts.
22870202 2012 In vitro and in vivo prostate cancer metastasis and chemoresistance can be modulated by expression of either CD44 or CD147.
22865879 2012 The liberation of CD44 intracellular domain modulates adenoviral vector transgene expression.
22855175 2013 CD44+/CD24- breast cancer cells isolated from MCF-7 cultures exhibit enhanced angiogenic properties.
22847005 2012 Hyaluronan-CD44v3 interaction with Oct4-Sox2-Nanog promotes miR-302 expression leading to self-renewal, clonal formation, and cisplatin resistance in cancer stem cells from head and neck squamous cell carcinoma.
22843930 2012 Decreased immunoexpression of standard form of CD44 is an independent favourable predictor of nodal metastasis in colorectal carcinoma.
22842095 2013 Perivascular stem cell niche in head and neck cancer.
22839505 2012 CD44/CD24 expression in recurrent gastric cancer: a retrospective analysis.
22836803 2012 Impact of ER? and CD44 expression on the prognosis of patients with stage II colon cancer.
22807608 2012 Osteopontin increases hepatocellular carcinoma cell growth in a CD44 dependant manner.
22804494 2012 Primary cardiac sarcomas may develop from resident or bone marrow-derived mesenchymal stem cells: use of immunohistochemistry including CD44 and octamer binding protein 3/4.
22788972 2012 CD44 rs13347 C>T polymorphism predicts breast cancer risk and prognosis in Chinese populations.
22784357 2012 Clinicopathological significance of fascin and CD44v6 expression in endometrioid carcinoma.
22770970 2012 Oropharyngeal malignant epithelial cell, lymphocyte and macrophage CD44 surface receptors for hyaluronate are expressed in sustained EBV infection: immunohistochemical data and EBV DNA tissue indices.
22753277 2013 Increased hyaluronan content and stromal cell CD44 associate with HER2 positivity and poor prognosis in human breast cancer.
22740326 2013 Co-expression of CD133(+)/CD44(+) in human colon cancer and liver metastasis.
22740085 2013 Cancer stem-like cells enriched with CD29 and CD44 markers exhibit molecular characteristics with epithelial-mesenchymal transition in squamous cell carcinoma.
22733437 2013 FAK, CD44v6, c-Met and EGFR in colorectal cancer parameters: tumour progression, metastasis, patient survival and receptor crosstalk.
22726066 2012 CD44 in human glioma correlates with histopathological grade and cell migration.
22711991 2012 LRP-1--CD44, a new cell surface complex regulating tumor cell adhesion.
22706704 2013 Role of CD44 expression in non-tumor tissue on intrahepatic recurrence of hepatocellular carcinoma.
22673910 2012 Alternative splicing of CD44 mRNA by ESRP1 enhances lung colonization of metastatic cancer cell.
22673507 2012 THAP11, a novel binding protein of PCBP1, negatively regulates CD44 alternative splicing and cell invasion in a human hepatoma cell line.
22654106 2012 Primary mesenchymal stem and progenitor cells from bone marrow lack expression of CD44 protein.
22637644 2012 The non-coding 3' UTR of CD44 induces metastasis by regulating extracellular matrix functions.
22621373 2012 CD44 enhances invasion of basal-like breast cancer cells by upregulating serine protease and collagen-degrading enzymatic expression and activity.
22610780 2012 CD44+/CD24- ovarian cancer cells demonstrate cancer stem cell properties and correlate to survival.
22606006 2012 Frequent gene amplification predicts poor prognosis in gastric cancer.
22561518 2012 Genome-wide association analyses identify 13 new susceptibility loci for generalized vitiligo.
22559040 2012 CD44s and CD44v6 in diagnosis and prognosis of human bladder cancer.
22552741 2012 CD44 enhances the epithelial-mesenchymal transition in association with colon cancer invasion.
22552294 2012 CD44s regulates the TGF-?-mediated mesenchymal phenotype and is associated with poor prognosis in patients with hepatocellular carcinoma.
22525501 2011 [Relationship between CD44 expression or glycosylation and hepatocellular carcinoma metastasis].
22514625 2012 Epcam, CD44, and CD49f distinguish sphere-forming human prostate basal cells from a subpopulation with predominant tubule initiation capability.
22499789 2012 Expression-based genome-wide association study links the receptor CD44 in adipose tissue with type 2 diabetes.
22493711 2012 A multi-cancer mesenchymal transition gene expression signature is associated with prolonged time to recurrence in glioblastoma.
22491449 2012 CD44 participates in IP-10 induction in cells in which hepatitis C virus RNA is replicating, through an interaction with Toll-like receptor 2 and hyaluronan.
22473523 2013 Role of hyaluronan synthase 2 to promote CD44-dependent oral cavity squamous cell carcinoma progression.
22456539 2012 Gottron's papules exhibit dermal accumulation of CD44 variant 7 (CD44v7) and its binding partner osteopontin: a unique molecular signature.
22449225 2012 CD44 expression in plexiform lesions of idiopathic pulmonary arterial hypertension.
22437554 2012 Genome-wide association study identifies three common variants associated with serologic response to vitamin E supplementation in men.
22433859 2012 Identification of function for CD44 intracytoplasmic domain (CD44-ICD): modulation of matrix metalloproteinase 9 (MMP-9) transcription via novel promoter response element.
22429811 2012 Morphophenotypic characteristics of intralymphatic cancer and stromal cells susceptible to lymphogenic metastasis.
22389315 2012 P-cadherin is coexpressed with CD44 and CD49f and mediates stem cell properties in basal-like breast cancer.
22386367 2012 Regulation of CD44 expression by tumor necrosis factor-? and its potential role in breast cancer cell migration.
22363471 2012 Receptors for hyaluronic acid and poliovirus: a combinatorial role in glioma invasion?
22335271 2012 Identification of glycoprotein markers for pancreatic cancer CD24+CD44+ stem-like cells using nano-LC-MS/MS and tissue microarray.
22322379 2012 Epithelial mesenchymal transition correlates with CD24+CD44+ and CD133+ cells in pancreatic cancer.
22321833 2012 Heparin/heparan sulfate/CD44-v3 enhances cell migration in term placenta-derived immortalized human trophoblast cells.
22307465 2012 A novel CD44v6 targeting antibody fragment with improved tumor-to-blood ratio.
22293754 2012 Modulation of glucose metabolism by CD44 contributes to antioxidant status and drug resistance in cancer cells.
22278305 2012 Dermal distribution of hyaluronan in psoriatic arthritis; coexistence of CD44, MMP3 and MMP9.
22272243 2012 Anti-tumor effect against human cancer xenografts by a fully human monoclonal antibody to a variant 8-epitope of CD44R1 expressed on cancer stem cells.
22271686 2012 CD44 proteolysis increases CREB phosphorylation and sustains proliferation of thyroid cancer cells.
22270319 2012 The interaction between CD44 on tumour cells and hyaluronan under physiologic flow conditions: implications for metastasis formation.
22266115 2012 Inhibition of fatty acid synthase attenuates CD44-associated signaling and reduces metastasis in colorectal cancer.
22242150 2012 CD44 expression in oro-pharyngeal carcinoma tissues and cell lines.
22237177 2011 Characteristic genes in luminal subtype breast tumors with CD44+CD24-/low gene expression signature.
22218639 2013 The effect of hyaluronic acid on osteopontin and CD44 mRNA of fibroblast-like synoviocytes in patients with osteoarthritis of the knee.
22216242 2011 Soluble CD44 interacts with intermediate filament protein vimentin on endothelial cell surface.
22213301 2012 Intense CD44 expression is a negative prognostic factor in tonsillar and base of tongue cancer.
22205660 2012 Single nucleotide polymorphisms in the Toll-like receptor 3 and CD44 genes are associated with persistence of vaccine-induced immunity to the serogroup C meningococcal conjugate vaccine.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
22152097 2011 Differentiation of breast cancer stem cells by knockdown of CD44: promising differentiation therapy.
22135720 2011 Clinicopathologic significance of putative stem cell markers, CD44 and nestin, in gastric adenocarcinoma.
22130902 2012 Effect of EpCAM, CD44, CD133 and CD166 expression on patient survival in tumours of the ampulla of Vater.
22125838 2011 [The relationship between CD44 and immune escape in gastric carcinoma].
22119938 2012 A CD44?/CD24? phenotype is a poor prognostic marker in early invasive breast cancer.
22119814 2011 The utility of CD44, CD117 and CD133 in identification of cancer stem cells (CSC) in oral squamous cell carcinomas (OSCC).
22076958 2012 CD133 and CD44 are universally overexpressed in GIST and do not represent cancer stem cell markers.
22072421 2012 Role of CD44 in the organization of keratinocyte pericellular hyaluronan.
22069487 2011 CD44 upregulation in E-cadherin-negative esophageal cancers results in cell invasion.
22068886 2012 Glycoengineering of HCELL, the human bone marrow homing receptor: sweetly programming cell migration.
22048598 Quantitative assessment of expression of cell adhesion molecule (CD44) splice variants: CD44 standard (CD44s) and v5, v6 isoforms in oral leukoplakias: an immunohistochemical study.
22024057 Significance of CD44s and CD44v6 expression in pancreaticobiliary maljunction.
22021370 2011 Leukocyte ligands for endothelial selectins: specialized glycoconjugates that mediate rolling and signaling under flow.
22014860 2012 Immunophenotyping analysis in invasive micropapillary carcinoma of the breast: role of CD24 and CD44 isoforms expression.
21993315 2012 CD44 activation enhances acute monoblastic leukemia cell survival via Mcl-1 upregulation.
21957977 2011 CD44 isoforms are heterogeneously expressed in breast cancer and correlate with tumor subtypes and cancer stem cell markers.
21953074 2012 CD44 is a biomarker associated with human prostate cancer radiation sensitivity.
21935404 2011 Drug-tolerant cancer cells show reduced tumor-initiating capacity: depletion of CD44 cells and evidence for epigenetic mechanisms.
21935375 2011 The phenotypic radiation resistance of CD44+/CD24(-or low) breast cancer cells is mediated through the enhanced activation of ATM signaling.
21933023 2012 Intrinsic growth deficiencies of mesenchymal stromal cells in myelodysplastic syndromes.
21912471 2011 Relationship between LYVE-1, VEGFR-3 and CD44 gene expressions and lymphatic metastasis in gastric cancer.
21898409 2012 CD133 and CD44 cell surface markers do not identify cancer stem cells in primary human gastric tumors.
21895545 2012 Prognostic value of serum CD44, intercellular adhesion molecule-1 and vascular cell adhesion molecule-1 levels in patients with indolent non-Hodgkin lymphomas.
21849440 2011 Epstein-Barr virus latent membrane protein 1 induces cancer stem/progenitor-like cells in nasopharyngeal epithelial cell lines.
21835433 2012 CD44(+)/CD24(-/low) cancer stem/progenitor cells are more abundant in triple-negative invasive breast carcinoma phenotype and are associated with poor outcome.
21833756 2011 Silencing of CD44 by siRNA suppressed invasion, migration and adhesion to matrix, but not secretion of MMPs, of cholangiocarcinoma cells.
21830016 2011 Serum CD44 levels and overall survival in patients with HER2-positive breast cancer.
21829201 2011 Sequential expression of putative stem cell markers in gastric carcinogenesis.
21827751 2011 CD44 and HCELL: preventing hematogenous metastasis at step 1.
21824412 2011 Differential expression of HIF-1? in CD44+CD24-/low breast ductal carcinomas.
21819617 2011 Prognostic significance of CD44s expression in resected non-small cell lung cancer.
21813394 2011 Expression of CD44, CD24 and ESA in pancreatic adenocarcinoma cell lines varies with local microenvironment.
21804359 2011 Implications of single nucleotide polymorphisms in CD44 exon 2 for risk of breast cancer.
21802218 2011 Clinicopathologic correlation of cancer stem cell markers CD44, CD24, VEGF and HIF-1? in ductal carcinoma in situ and invasive ductal carcinoma of breast: an immunohistochemistry-based pilot study.
21768350 2011 Serine protease autotransporters from Shigella flexneri and pathogenic Escherichia coli target a broad range of leukocyte glycoproteins.
21768115 2011 Glycosaminoglycans and glucose prevent apoptosis in 4-methylumbelliferone-treated human aortic smooth muscle cells.
21764578 2012 Co-expression of stem cell genes CD133 and CD44 in colorectal cancers with early liver metastasis.
21749678 2011 The role of a new CD44st in increasing the invasion capability of the human breast cancer cell line MCF-7.
21743962 2011 Fragmented hyaluronan is an autocrine chemokinetic motility factor supported by the HAS2-HYAL2/CD44 system on the plasma membrane.
21731740 2011 Tumor initiating cells in esophageal squamous cell carcinomas express high levels of CD44.
21718681 2011 Survivin is a novel target of CD44-promoted breast tumor invasion.
21708929 2011 Severe lung fibrosis requires an invasive fibroblast phenotype regulated by hyaluronan and CD44.
21701559 2011 Direct reprogramming of stem cell properties in colon cancer cells by CD44.
21694464 2010 Diagnostic and prognostic tissuemarkers in clear cell and papillary renal cell carcinoma.
21685938 2012 Stem cell marker (Nanog) and Stat-3 signaling promote MicroRNA-21 expression and chemoresistance in hyaluronan/CD44-activated head and neck squamous cell carcinoma cells.
21680714 2011 c-Met recruits ICAM-1 as a coreceptor to compensate for the loss of CD44 in Cd44 null mice.
21678082 2011 Nuclear translocation of ?-catenin correlates with CD44 upregulation in Helicobacter pylori-infected gastric carcinoma.
21649540 2011 Activation of CD44, a receptor for extracellular matrix components, protects chronic lymphocytic leukemia cells from spontaneous and drug induced apoptosis through MCL-1.
21645921 2011 Involvement of osteopontin and its signaling molecule CD44 in clinicopathological features of adult T cell leukemia.
21633165 2011 The JAK2/STAT3 signaling pathway is required for growth of CD44?CD24? stem cell-like breast cancer cells in human tumors.
21632186 2011 Correlation between E-cadherin and CD44 adhesion molecules expression and cervical lymph node metastasis in oral tongue SCC: Predictive significance or not.
21630198 2011 Expression of CD44 and MMP-2: possible association with histopathological features of pleuro-pulmonary solitary fibrous tumors.
21618132 2011 Hematogenous metastasis: roles of CD44v and alternative sialofucosylated selectin ligands.
21618131 2011 Significance of serum glycoprotein profiles in spontaneous tolerance after liver allograft transplantation.
21617876 2011 CD44 as a stem cell marker in head and neck squamous cell carcinoma.
21570715 2011 Role of hyaluronan and hyaluronan-binding proteins in human asthma.
21546273 Versican and CD44 in in vitro valvular interstitial cell injury and repair.
21493336 2011 Distinct epigenetic profiling in head and neck squamous cell carcinoma stem cells.
21489997 2011 Met receptors induce Sam68-dependent cell migration by activation of alternate extracellular signal-regulated kinase family members.
21482826 2011 HIV-1 p17 matrix protein interacts with heparan sulfate side chain of CD44v3, syndecan-2, and syndecan-4 proteoglycans expressed on human activated CD4+ T cells affecting tumor necrosis factor alpha and interleukin 2 production.
21473743 2011 Invasive behavior of ulcerative colitis-associated carcinoma is related to reduced expression of CD44 extracellular domain: comparison with sporadic colon carcinoma.
21471434 2011 CD44-SLC1A2 gene fusions in gastric cancer.
21471214 2011 Differential use of chondroitin sulfate to regulate hyaluronan binding by receptor CD44 in Inflammatory and Interleukin 4-activated Macrophages.
21454519 2011 Hyaluronan facilitates transforming growth factor-?1-dependent proliferation via CD44 and epidermal growth factor receptor interaction.
21424816 2011 Neuroblastoma cells negative for CD44 possess tumor-initiating properties.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21411116 2011 Identification of CD44 as a downstream target of noncanonical NF-?B pathway activated by human T-cell leukemia virus type 1-encoded Tax protein.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21397861 2011 CD44 variant regulates redox status in cancer cells by stabilizing the xCT subunit of system xc(-) and thereby promotes tumor growth.
21393860 2011 CD44 splice isoform switching in human and mouse epithelium is essential for epithelial-mesenchymal transition and breast cancer progression.
21376257 2011 Identification of cancer stem-like CD44+ cells in human nasopharyngeal carcinoma cell line.
21374592 2012 Osteopontin stimulates autophagy via integrin/CD44 and p38 MAPK signaling pathways in vascular smooth muscle cells.
21356346 2011 Role of hyaluronan-mediated CD44 signaling in head and neck squamous cell carcinoma progression and chemoresistance.
21331451 2011 Clinical significance of intraperitoneal CD44 mRNA levels of magnetically separated CD45-negative EpCAM-positive cells for peritoneal recurrence and prognosis in stage II and III gastric cancer patients.
21299347 2011 CD44(+)/CD24(-) cells are transit progenitors and do not determine the molecular subtypes and clinical parameters in breast carcinomas.
21294926 2011 Enhancive effects of Lewis y antigen on CD44-mediated adhesion and spreading of human ovarian cancer cell line RMG-I.
21279958 Expression of CD44s and CD44v6 in lung cancer and their correlation with prognostic factors.
21278261 2011 Interplay between RAGE, CD44, and focal adhesion molecules in epithelial-mesenchymal transition of alveolar epithelial cells.
21269460 2011 Initial characterization of the human central proteome.
21258793 2011 CD44 in hematological neoplasias.
21257905 2011 Enforced hematopoietic cell E- and L-selectin ligand (HCELL) expression primes transendothelial migration of human mesenchymal stem cells.
21257828 2011 Selectin-mediated recruitment of bone marrow stromal cells in the postischemic cerebral microvasculature.
21254647 2010 [Detection of PD4, CD44, PCNA protein and its clinical significance in human laryngeal carcinoma].
21215700 2011 OPN promotes survival of activated T cells by up-regulating CD44 in patients with oral lichen planus.
21194677 2011 Identification of a systemic lupus erythematosus susceptibility locus at 11p13 between PDHX and CD44 in a multiethnic study.
21179550 2010 Synergistic effect of hyaluronate fragments in retinaldehyde-induced skin hyperplasia which is a Cd44-dependent phenomenon.
21151997 2010 Membrane-Associated RING-CH proteins associate with Bap31 and target CD81 and CD44 to lysosomes.
21136024 2011 Role of versican V0/V1 and CD44 in the regulation of human melanoma cell behavior.
21124918 2010 Non-small cell lung cancer cells expressing CD44 are enriched for stem cell-like properties.
21105049 2011 Germline polymorphisms in genes involved in the CD44 signaling pathway are associated with clinical outcome in localized gastric adenocarcinoma.
21098716 2010 Endothelial cell-initiated signaling promotes the survival and self-renewal of cancer stem cells.
21087933 2011 Low cholesterol triggers membrane microdomain-dependent CD44 shedding and suppresses tumor cell migration.
21078678 2011 V3 versican isoform alters the behavior of human melanoma cells by interfering with CD44/ErbB-dependent signaling.
21055388 2010 miR-199a-3p targets CD44 and reduces proliferation of CD44 positive hepatocellular carcinoma cell lines.
20974992 2010 Neutrophil migration across intestinal epithelium: evidence for a role of CD44 in regulating detachment of migrating cells from the luminal surface.
20971508 2011 Cyclopamine induces eosinophilic differentiation and upregulates CD44 expression in myeloid leukemia cells.
20969572 2010 Identification of CD44 as a cell surface marker for Müller glia precursor cells.
20962267 2010 Podoplanin associates with CD44 to promote directional cell migration.
20956971 2011 RHAMM/ERK interaction induces proliferative activities of cementifying fibroma cells through a mechanism based on the CD44-EGFR.
20920234 2010 Epigenetic regulation of CD44 in Hodgkin and non-Hodgkin lymphoma.
20856229 2010 De novo expression of CD44 variants in sporadic and hereditary gastric cancer.
20851866 2011 Impact of constitutional polymorphisms in VCAM1 and CD44 on CD34+ cell collection yield after administration of granulocyte colony-stimulating factor to healthy donors.
20843027 2010 Combinatorial selection of DNA thioaptamers targeted to the HA binding domain of human CD44.
20837694 2010 CD44 expression predicts local recurrence after radiotherapy in larynx cancer.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20809185 2011 Potential role of serum level of soluble CD44 and IFN-? in B-cell chronic lymphocytic leukemia.
20806065 2010 Host genetic factors and vaccine-induced immunity to HBV infection: haplotype analysis.
20799279 2011 Blood-derived human osteoclast resorption activity is impaired by Hyaluronan-CD44 engagement via a p38-dependent mechanism.
20698358 2009 Epidermal growth factor receptor gene promoter methylation in primary colorectal tumors and corresponding metastatic sites: a new perspective for an "old" therapeutic target.
20696077 2010 Nuclear beta-catenin and CD44 upregulation characterize invasive cell populations in non-aggressive MCF-7 breast cancer cells.
20670691 2010 CD44-independent activation of the Met signaling pathway by HGF and InlB.
20663884 2010 Analysis of CD44-hyaluronan interactions in an artificial membrane system: insights into the distinct binding properties of high and low molecular weight hyaluronan.
20663864 2010 Transportin regulates nuclear import of CD44.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20606732 2010 CD44 and p53 immunoexpression patterns in NF1 neoplasms - indicators of malignancy and infiltration.
20606680 2010 Prognostic impact of the expression of putative cancer stem cell markers CD133, CD166, CD44s, EpCAM, and ALDH1 in colorectal cancer.
20605145 2010 Expression of E- and N-cadherin and CD44 in endometrium and hydrosalpinges from infertile women.
20588206 2010 Intragraft tubular vimentin and CD44 expression correlate with long-term renal allograft function and interstitial fibrosis and tubular atrophy.
20562647 2010 Immunoexpression of Ezrin and CD44 in patients with osteosarcoma.
20552237 2010 Hyaluronan inhibits p38 mitogen-activated protein kinase via the receptors in rheumatoid arthritis chondrocytes stimulated with fibronectin fragment.
20549562 2010 Osteopontin expression is an independent adverse prognostic factor in resectable gastrointestinal stromal tumor and its interaction with CD44 promotes tumor proliferation.
20530438 2010 Unique SNP in CD44 intron 1 and its role in breast cancer development.
20526812 2011 CD133+ CD44+ subgroups may be human small intestinal stem cells.
20525896 2010 Naturally activated V gamma 4 gamma delta T cells play a protective role in tumor immunity through expression of eomesodermin.
20522558 2010 Proinflammatory cytokines induce hyaluronan synthesis and monocyte adhesion in human endothelial cells through hyaluronan synthase 2 (HAS2) and the nuclear factor-kappaB (NF-kappaB) pathway.
20491779 2010 Combined inhibitory effect of formestane and herceptin on a subpopulation of CD44+/CD24low breast cancer cells.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20454640 2010 Expression of monocarboxylate transporters 1, 2, and 4 in human tumours and their association with CD147 and CD44.
20416163 2010 [Effect of CD44 gene silence on multi-drug resistance reversal and biologic activity in K562/A02 cells].
20405247 2011 The CD44+/CD24- phenotype relates to 'triple-negative' state and unfavorable prognosis in breast cancer patients.
20403620 2010 Absent CD44v6 expression is an independent predictor of poor urothelial bladder cancer outcome.
20382854 2010 Identification of CD44 as a senescence-induced cell adhesion gene responsible for the enhanced monocyte recruitment to senescent endothelial cells.
20374021 2010 Expression of CD44V6 in parotid pleomorphic adenoma and carcinoma ex pleomorphic adenoma.
20361869 2010 PCBP-1 regulates alternative splicing of the CD44 gene and inhibits invasion in human hepatoma cell line HepG2 cells.
20357818 2010 HGF-promoted motility in primary human melanocytes depends on CD44v6 regulated via NF-kappa B, Egr-1, and C/EBP-beta.
20306693 2008 Study of soluble CD44 and its expression by mononuclear cells in children with acute lymphoblastic leukemia: its relation to prognostic factors.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20228222 2010 In situ identification of putative cancer stem cells by multiplexing ALDH1, CD44, and cytokeratin identifies breast cancer patients with poor prognosis.
20212041 2010 The transmembrane domains of L-selectin and CD44 regulate receptor cell surface positioning and leukocyte adhesion under flow.
20211062 2010 [CD44 variant increases the invasive ability of human breast cancer cell line MCF-7 cells].
20200161 2010 Stromal hyaluronan interaction with epithelial CD44 variants promotes prostate cancer invasiveness by augmenting expression and function of hepatocyte growth factor and androgen receptor.
20199686 2010 Selective regain of egfr gene copies in CD44+/CD24-/low breast cancer cellular model MDA-MB-468.
20193563 2009 [Expression of P53, COX2 and CD44V6 in early-stage squamous carcinoma of cervix with lymph vascular space invasion positive and negative and its relationship with prognosis].
20178130 2010 Induction of CD44 cleavage in articular chondrocytes.
20157733 2010 Clinical significance of pAKT and CD44v6 overexpression with breast cancer.
20146103 2010 Clinical implication and mitotic effect of CD44 cleavage in relation to osteopontin/CD44 interaction and dysregulated cell cycle protein in gastrointestinal stromal tumor.
20142144 2009 Atomic force microscopy imaging of supramolecular organization of hyaluronan and its receptor CD44.
20127679 2010 The DC-SIGN family member LSECtin is a novel ligand of CD44 on activated T cells.
20121756 2010 Mast cell adhesion to bronchial smooth muscle in asthma specifically depends on CD51 and CD44 variant 6.
20098615 2010 Application of gene network analysis techniques identifies AXIN1/PDIA2 and endoglin haplotypes associated with bicuspid aortic valve.
20093489 2010 Aging fibroblasts resist phenotypic maturation because of impaired hyaluronan-dependent CD44/epidermal growth factor receptor signaling.
20093404 2010 CD44 activation in mature B-cell malignancies by a novel recurrent IGH translocation.
20083228 2010 Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20042890 2010 Immunohistochemical analysis of the S100A1, S100B, CD44 and Bcl-2 antigens and the rate of cell proliferation assessed by Ki-67 antibody in benign and malignant melanocytic tumours.
20019840 2009 Twist modulates breast cancer stem cells by transcriptional regulation of CD24 expression.
19996285 2010 Chemosensitivity profiles identify polymorphisms in the p53 network genes 14-3-3tau and CD44 that affect sarcoma incidence and survival.
19965872 2010 Tumor necrosis factor-alpha regulates transforming growth factor-beta-dependent epithelial-mesenchymal transition by promoting hyaluronan-CD44-moesin interaction.
19955840 2009 Expression of CD44s in incidental prostate cancer is more strongly associated with Gleason scores on subsequent radical prostatectomies than conventional prognostic parameters.
19952968 2010 CD44v6 expression in intraductal papillary mucinous neoplasms of the pancreas.
19937401 2009 The Relationships Between Loss of Standard CD44 Expression and Lymph Node, Liver Metastasis in T3 Colorectal Carcinoma.
19914206 2010 Up-regulation of hyaluronan receptors in Toxoplasma gondii-infected monocytic cells.