Tchem | Tumor necrosis factor receptor superfamily member 5 |
Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.
This gene is a member of the TNF-receptor superfamily. The encoded protein is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Mutations affecting this gene are the cause of autosomal recessive hyper-IgM immunodeficiency type 3 (HIGM3). Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Nov 2014]
This gene is a member of the TNF-receptor superfamily. The encoded protein is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Mutations affecting this gene are the cause of autosomal recessive hyper-IgM immunodeficiency type 3 (HIGM3). Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Nov 2014]
Comments
Property Summary
Ligand Count | 2 |
NCBI Gene PubMed Count | 510 |
PubMed Score | 3120.26 |
PubTator Score | 2382.54 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Arthritis, Rheumatoid | 174 | 0.0 | 0.0 |
Breast Neoplasms | 445 | 0.0 | 0.0 |
Hyper-IgM Immunodeficiency Syndrome | 3 | 0.0 | 0.0 |
Mucocutaneous Lymph Node Syndrome | 4 | 0.0 | 0.0 |
Status Epilepticus | 98 | 0.0 | 0.0 |
Disease | Target Count | P-value |
---|---|---|
malignant mesothelioma | 3232 | 2.8e-06 |
active Crohn's disease | 922 | 9.6e-04 |
intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 2.6e-03 |
osteosarcoma | 7950 | 3.0e-03 |
lung cancer | 4740 | 1.6e-02 |
active ulcerative colitis | 764 | 2.0e-02 |
cutaneous lupus erythematosus | 1057 | 2.3e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Multiple Sclerosis | 540 | 4.339 | 2.2 |
Rheumatoid arthritis | 1191 | 4.095 | 2.0 |
Kawasaki disease | 28 | 3.127 | 1.6 |
Crohn's disease | 321 | 0.0 | 3.0 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Graves' disease | 24 | 0.0 | 5.0 |
Disease | Target Count |
---|---|
Immunodeficiency With Hyper-Igm, Type 3 | 1 |
Disease | log2 FC | p |
---|---|---|
active Crohn's disease | 1.845 | 9.6e-04 |
active ulcerative colitis | 1.614 | 2.0e-02 |
cutaneous lupus erythematosus | 1.100 | 2.3e-02 |
intraductal papillary-mucinous carcinoma... | -1.100 | 2.6e-03 |
lung cancer | -1.100 | 1.6e-02 |
malignant mesothelioma | -2.200 | 2.8e-06 |
osteosarcoma | -1.423 | 3.0e-03 |
Species | Source | Disease |
---|---|---|
Inparanoid OMA EggNOG | ||
Inparanoid EggNOG | ||
Inparanoid OMA | ||
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG |
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDT 1 - 70 WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSD 71 - 140 TICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILL 141 - 210 VLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ 211 - 277 //